DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and Shox2

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_037160.2 Gene:Shox2 / 25546 RGDID:3674 Length:331 Species:Rattus norvegicus


Alignment Length:335 Identity:104/335 - (31%)
Similarity:134/335 - (40%) Gaps:94/335 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 PLWGA-VPLATPPG------------GGPAGAGGALQPGGSGSSYGSDGNMSSNPNSSNSNTTHS 321
            ||.|| .|....||            ||..||||    ||.|...|..|                
  Rat    33 PLRGAKEPGCVEPGRDDRSSPAVRAAGGGGGAGG----GGGGGGGGGGG---------------- 77

  Fly   322 NGHNTNSGSGCGDSSAGSGRLSLPALSPDSGSRD-SRSPDAD---------ANRMIDIEGEDSES 376
                  :|.|.....||.||  .|....|.|:.: ||.|.:.         .:|..|.:|.:.|.
  Rat    78 ------AGGGGAGGGAGGGR--SPVRELDMGAAERSREPGSPRLTEVSPELKDRKEDAKGMEDEG 134

  Fly   377 QDSDQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAKWRR 441
            |  .:.|.||:||.|:.|||:|||:.||::|||....||:|:.|..||||||||||.|||||.|:
  Rat   135 Q--TKIKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRK 197

  Fly   442 HQRVNLIKQRDSPSTSSSPTPLVNPVVSPVSPIPVPVPVAVPESGQQKQPYPYSTSNMCNTSSSS 506
             |...|.|.....:.|......|.|.|: |..:.:                |:...:.||.:..|
  Rat   198 -QENQLHKGVLIGAASQFEACRVAPYVN-VGALRM----------------PFQQDSHCNVTPLS 244

  Fly   507 SNSQPCNTINPGSKMSSKTSSVSSNQHMEEPAAAVATASPTASAPLSMGGENSAFRALPMTLPMP 571
            ...|....::         |:|:...|...|..|       |.||..|      |.|.|..||: 
  Rat   245 FQVQAQLQLD---------SAVAHAHHHLHPHLA-------AHAPYMM------FPAPPFGLPL- 286

  Fly   572 MTLPTASAAA 581
            .||...||:|
  Rat   287 ATLAADSASA 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 33/51 (65%)
Shox2NP_037160.2 Homeobox 143..197 CDD:395001 33/53 (62%)
OAR 311..327 CDD:397759
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.