DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and gbx2

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_694496.1 Gene:gbx2 / 245948 ZFINID:ZDB-GENE-020509-2 Length:342 Species:Danio rerio


Alignment Length:286 Identity:82/286 - (28%)
Similarity:118/286 - (41%) Gaps:71/286 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 PYTSFPTWPAHHPLWG----------------AVPLATPPGGGPAGAG----GALQPGGSGSSY- 301
            |.::.||...|||:.|                :..:||.|||..:...    .|.:..||.|.: 
Zfish    67 PQSALPTTHPHHPIPGLPSSFCSSLAQGMALTSTLMATLPGGFSSSPSQQHQDAARKLGSQSIHA 131

  Fly   302 -----------GSDG------NMSSNPNSSNSNTTHSN---GHNTNSGSGCGDSSAGSGRLSLPA 346
                       |.||      :.:|.|:..:|.:.|::   ||:.:      ||..........:
Zfish   132 MFDKSQDIRLDGEDGKTFATKDSTSIPSFHDSQSVHTSTVRGHSKD------DSKEDDCHRKDES 190

  Fly   347 LSPDSG---SRDSRSP--------DADANRMID--IEGEDSESQDSDQPKFRRNRTTFSPEQLDE 398
            .|.||.   |.|...|        |.|.:..:|  :.|.:.....:...|.||.||.|:.|||.|
Zfish   191 FSMDSDLDYSSDDNGPGNAMCQKEDGDGSGGLDDGVHGGNGAGNTTSTGKNRRRRTAFTSEQLLE 255

  Fly   399 LEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAKWRRHQRVNLIKQRDSPSTSSSPTPL 463
            |||||....|..:..|.::|....|||.:|::||.||||||:|.:..|:..:...||.       
Zfish   256 LEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRVKAGNVNSKTGEPSR------- 313

  Fly   464 VNPVVSPVSPIPVPVP-VAVPESGQQ 488
             ||.:  |.||||.|. .|:....||
Zfish   314 -NPKI--VVPIPVHVSRFAIRSQHQQ 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 26/51 (51%)
gbx2NP_694496.1 Homeobox 244..297 CDD:278475 26/52 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.