DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and Vax1

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_033527.1 Gene:Vax1 / 22326 MGIID:1277163 Length:338 Species:Mus musculus


Alignment Length:316 Identity:81/316 - (25%)
Similarity:118/316 - (37%) Gaps:83/316 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 SGSGCGDSSAGSGRLSLPALSPDSGSRDSRSPDADANRMI---DIEGEDSE-----SQDSDQPKF 384
            ||||..:..              :.|:.:.|.|.|..|.|   |.:|...|     ..|.|:|| 
Mouse    52 SGSGASEDC--------------NKSKSNSSADPDYCRRILVRDAKGSIREIILPKGLDLDRPK- 101

  Fly   385 RRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAKWRRHQRVNLIK 449
             |.||:|:.|||..||.||.:..|.....|.:||.:..|||.:|:|||.|||.|.::.|      
Mouse   102 -RTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQ------ 159

  Fly   450 QRDSPSTSSSPTPLVNPVVSPVSPI----------PVPVPVAVPESGQQKQPYPYSTSNMCNTSS 504
            .:||...|     :|:...:..|.:          |..:|..:|                     
Mouse   160 GKDSELRS-----VVSETAATCSVLRLLEQGRLLSPPGLPALLP--------------------- 198

  Fly   505 SSSNSQPCNTINPGSKMSSKT-SSVSSNQHMEEPAAAVATASPTASAPLSMGGENS-AFRALPMT 567
                  ||.|...||.:...: .::.:.......|||.|.|:.||..|.....::. |....|..
Mouse   199 ------PCATGALGSALRGPSLPALGAGAAAGSAAAAAAAAAATAPGPAGAASQHQPAVGGAPGP 257

  Fly   568 LP-----MPMTLPTASAAAFAL---SFARQYIAKYMGTPLNL-GHGSSPIQAQSGR 614
            .|     :....||||...|:|   |......::....||.: |..:..:|..|.|
Mouse   258 GPAGPGGLHAGAPTASHGLFSLPVPSLLGSVASRLSSAPLTMAGSLAGNLQELSAR 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 25/51 (49%)
Vax1NP_033527.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69 5/30 (17%)
Homeobox 103..156 CDD:306543 25/52 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 239..269 4/29 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..338
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.