DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and npax-3

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_502006.2 Gene:npax-3 / 187848 WormBaseID:WBGene00011257 Length:205 Species:Caenorhabditis elegans


Alignment Length:151 Identity:35/151 - (23%)
Similarity:47/151 - (31%) Gaps:55/151 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 QPGGSGSSYGSDGNMSSNPNSSNSNTT-----------------------------------HSN 322
            |...|.||....|:.:|:|.|...|.:                                   |:|
 Worm    45 QQSDSSSSVDESGSKTSSPTSMQQNPSQDGRKNRKKGTNLYGRPYCPGRPLSMEERTRIIQLHNN 109

  Fly   323 GHNTNSGS-------GCGDSSAGSGRLS---LPALSPDSGSRDSRSPDADANRMIDIEGEDSESQ 377
            |...|:.|       ||........|.:   |||.||:  .|.||      .|...:||  |..:
 Worm   110 GMKVNAISKSLCISHGCVSKIISRFRATGVLLPACSPE--QRKSR------KRKSSMEG--SAME 164

  Fly   378 DSDQPKFRRNRTTFSPEQLDE 398
            .|..|.|...:.....|.|:|
 Worm   165 QSFIPVFVSMQDANGNEYLNE 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 3/11 (27%)
npax-3NP_502006.2 PAX 78..200 CDD:128645 26/118 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.