powered by:
Protein Alignment toe and pha-2
DIOPT Version :9
Sequence 1: | NP_524041.2 |
Gene: | toe / 39418 |
FlyBaseID: | FBgn0036285 |
Length: | 640 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_508131.4 |
Gene: | pha-2 / 187454 |
WormBaseID: | WBGene00004011 |
Length: | 214 |
Species: | Caenorhabditis elegans |
Alignment Length: | 64 |
Identity: | 30/64 - (46%) |
Similarity: | 39/64 - (60%) |
Gaps: | 1/64 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 379 SDQPKFRR-NRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAKWRR 441
|..|:.|: .:..|:.||.|.||.:||...|.....|:|||...:|||.:|:.||.||||||||
Worm 118 SKSPQKRKGGQIRFTNEQTDALEHKFDSHKYLSPQERKKLAKSLSLSERQVKTWFQNRRAKWRR 181
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
toe | NP_524041.2 |
HTH |
134..230 |
CDD:304362 |
|
Homeobox |
388..440 |
CDD:278475 |
24/51 (47%) |
pha-2 | NP_508131.4 |
Homeobox |
130..181 |
CDD:365835 |
25/50 (50%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.