DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and npax-2

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_508396.3 Gene:npax-2 / 185967 WormBaseID:WBGene00018591 Length:233 Species:Caenorhabditis elegans


Alignment Length:161 Identity:48/161 - (29%)
Similarity:73/161 - (45%) Gaps:13/161 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 TTVLAQPHSLSPSTPILTQGAPPAAALGGIFCGGSAAAGPGAAAAAATNLNALASQHRLLELSRF 142
            |:....|.|||.|:  |....||...........|.....|...:....| ::..:..:::|.:.
 Worm    67 TSDSGSPSSLSCSS--LDYDVPPPPQYEKDVARSSGRNQLGRTYSPGLPL-SMCEREEIVKLFQG 128

  Fly   143 GLRGYDLAQHMLSQQGAVSKLLGTLRPPGLIGGSKPKVA------TPTVVSKIEQYKRENPTIFA 201
            |.:..|:::.:......|||:|...|..|.:   |||.|      :|.|:: :..|:........
 Worm   129 GWKICDISKRLCVTHSCVSKILNRYRQTGSV---KPKDAKEGRTESPLVLA-VRDYRSRLGMCRQ 189

  Fly   202 WEIRERLITEGVCTNATAPSVSSINRILRNR 232
            .||||:||.:||||...|||.||||.|||.:
 Worm   190 SEIREQLIRDGVCTRDNAPSRSSINHILRTK 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362 34/101 (34%)
Homeobox 388..440 CDD:278475
npax-2NP_508396.3 PAX 97..218 CDD:128645 37/125 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.