DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and ceh-53

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_500361.3 Gene:ceh-53 / 182467 WormBaseID:WBGene00015651 Length:203 Species:Caenorhabditis elegans


Alignment Length:212 Identity:63/212 - (29%)
Similarity:93/212 - (43%) Gaps:53/212 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   376 SQDSDQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAKWR 440
            :|:|::.:.||.||.||..||:.||:.|.|..||.|..||.|..:|.|:|||:||||.|||||.|
 Worm    23 AQNSEERRVRRLRTAFSENQLELLEEAFLKCQYPDVQQRETLGKQTELAEARIQVWFKNRRAKAR 87

  Fly   441 RHQRVNLIKQRDSPSTSSSPTPLVNPVVSPVSPIPVPVPVAVPESGQQKQPYPYSTSNMCNTSSS 505
            :.||        :.||.|..|                    ..||.::      ..::.| ....
 Worm    88 KRQR--------NESTDSCST--------------------TEESNEE------GDADGC-LKKK 117

  Fly   506 SSNSQPCNTINPGSKMSSKTSSVSSNQHMEEPAAAVATASPTASA-PLSMGGENSAFRAL-PM-- 566
            :.|.....|..||:.:.:.:.|.::            |:.||..| ||:.....:.|.|. |.  
 Worm   118 AKNETTIITWTPGAALFNSSLSPTT------------TSIPTTPAPPLNFICHQNPFYAYNPYRN 170

  Fly   567 --TLPMPMTLPTASAAA 581
              |:|..:...|.:||:
 Worm   171 LNTIPTHLLAATTTAAS 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 30/51 (59%)
ceh-53NP_500361.3 Homeobox 35..81 CDD:365835 25/45 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.