DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and dsc-1

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_510497.1 Gene:dsc-1 / 181599 WormBaseID:WBGene00001096 Length:310 Species:Caenorhabditis elegans


Alignment Length:236 Identity:58/236 - (24%)
Similarity:84/236 - (35%) Gaps:78/236 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 ASY----GYAIH----PTHPH-------PYTSFPTWPAHHPLWGAVPLATPPGGGPAGAGGALQP 294
            |||    |.|:|    .::.|       |.|..|...||..  |.:|..:|              
 Worm    71 ASYYHNLGVALHNHFQMSNQHYLSDFDCPTTVSPISSAHET--GQLPQLSP-------------- 119

  Fly   295 GGSGSSYGSDGNMSS---NPNSSNSNTTHSNGHNTNSGSGCGDSSAGSGRLSLPALSPDS----G 352
                  |...||...   :|::..::....|.:..|:.......:.|:..|:...:|.|:    |
 Worm   120 ------YDHIGNQDPHMFSPHAYGNSMIPDNSYFENASRSISAPNVGNSTLNPSLMSSDNAQSCG 178

  Fly   353 SRDSRSPDADANRMIDIEGEDSESQDSDQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKL 417
            .|                              ||.||.|:..|...||..|.:||||....::.:
 Worm   179 GR------------------------------RRFRTNFTELQSTFLEDSFKESHYPDHKAKKYM 213

  Fly   418 AARTALSEARVQVWFSNRRAKWRRHQRVNLIKQRDSPSTSS 458
            |....:.|.|:.|||.||||||||.:.    :|||.....|
 Worm   214 ADFLKIPEDRITVWFQNRRAKWRRKEH----RQRDRTRNES 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 22/51 (43%)
dsc-1NP_510497.1 Homeobox 184..236 CDD:278475 22/51 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.