DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and egl-38

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_501836.1 Gene:egl-38 / 177876 WormBaseID:WBGene00001204 Length:289 Species:Caenorhabditis elegans


Alignment Length:259 Identity:83/259 - (32%)
Similarity:117/259 - (45%) Gaps:75/259 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 PILTQGAPPAA-ALGGIFCGGSAAAGPGAAAAAATNLNALASQHRLLELSRFGLRGYDLAQHMLS 155
            |:|:.|:.... .|||:|..|...|....|              :::|:|:.|.|..|:::.:..
 Worm    23 PLLSDGSHTGVNQLGGVFVNGRPLADTVRA--------------QIVEMSQHGTRPCDISRQLKV 73

  Fly   156 QQGAVSKLL------GTLRPPGLIGGSKPKVATPTVVSKIEQYKRENPTIFAWEIRERLITEGVC 214
            ..|.|||:|      |::| ||:|||||||||||.||..|..|||.|||:||||||::||.:.:|
 Worm    74 SHGCVSKILGRYYSTGSVR-PGVIGGSKPKVATPRVVECIAGYKRANPTMFAWEIRQKLIEDQIC 137

  Fly   215 TNATAPSVSSINRILRNRA--AERAAAEFARAASYGYAIHPTHPHPYTSFPTWP----AHHPLWG 273
            .....|||||||||:||::  |:.||                 |...||....|    :||.   
 Worm   138 GEENVPSVSSINRIVRNKSFMAQLAA-----------------PTSVTSSAARPSSATSHHQ--- 182

  Fly   274 AVPLATPPGG--------------------GPAGAGGALQPGG---SGSSYGSDGNMSSNPNSS 314
                .:||.|                    ..|.....:.|..   .|::|..:|.:.:.|..|
 Worm   183 ----RSPPRGVQQHMQQSTSVQQLQQLQLTSAATVNSLMTPPAFAMPGTAYSINGLLGTLPQPS 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362 52/101 (51%)
Homeobox 388..440 CDD:278475
egl-38NP_501836.1 PAX 29..153 CDD:128645 59/138 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.