Sequence 1: | NP_524041.2 | Gene: | toe / 39418 | FlyBaseID: | FBgn0036285 | Length: | 640 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_034591.1 | Gene: | Hoxb8 / 15416 | MGIID: | 96189 | Length: | 243 | Species: | Mus musculus |
Alignment Length: | 219 | Identity: | 51/219 - (23%) |
---|---|---|---|
Similarity: | 76/219 - (34%) | Gaps: | 61/219 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 259 YTSFPTWPAHHPLWGAVPLATPPGG------GPAGAGGALQPGGSGSSYGSDGNMSSNPNSSNSN 317
Fly 318 TTHSNGHNTN-----------------------------SGSGCGDSSAGSGRLSLPA-LSPDSG 352
Fly 353 SRDSRSPDADANRMIDIEGEDSESQDSDQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKL 417
Fly 418 AARTALSEARVQVWFSNRRAKWRR 441 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
toe | NP_524041.2 | HTH | 134..230 | CDD:304362 | |
Homeobox | 388..440 | CDD:278475 | 21/51 (41%) | ||
Hoxb8 | NP_034591.1 | Antp-type hexapeptide | 134..139 | 2/10 (20%) | |
Homeobox | 150..203 | CDD:395001 | 22/52 (42%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 203..243 | 0/1 (0%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |