DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and Hoxb8

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_034591.1 Gene:Hoxb8 / 15416 MGIID:96189 Length:243 Species:Mus musculus


Alignment Length:219 Identity:51/219 - (23%)
Similarity:76/219 - (34%) Gaps:61/219 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 YTSFPTWPAHHPLWGAVPLATPPGG------GPAGAGGALQPGGSGSSYGSDGNMSSNPNSSNSN 317
            ::.:.|..:..|.:.....|...||      ||:..|....|......|....::|:.|...|..
Mouse    10 FSKYKTGESLRPNYYDCGFAQDLGGRPTVVYGPSSGGSFQHPSQIQEFYHGPSSLSTAPYQQNPC 74

  Fly   318 TTHSNGHNTN-----------------------------SGSGCGDSSAGSGRLSLPA-LSPDSG 352
            ....:|...|                             :.||.|:.:.||.:...|. |.|   
Mouse    75 AVACHGDPGNFYGYDPLQRQSLFGAQDPDLVQYADCKLAAASGLGEEAEGSEQSPSPTQLFP--- 136

  Fly   353 SRDSRSPDADANRMIDIEGEDSESQDSDQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKL 417
               ...|.|.|.|                   ||.|.|:|..|..||||||..:.|.....|.::
Mouse   137 ---WMRPQAAAGR-------------------RRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEV 179

  Fly   418 AARTALSEARVQVWFSNRRAKWRR 441
            :....|:|.:|::||.|||.||::
Mouse   180 SHALGLTERQVKIWFQNRRMKWKK 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 21/51 (41%)
Hoxb8NP_034591.1 Antp-type hexapeptide 134..139 2/10 (20%)
Homeobox 150..203 CDD:395001 22/52 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..243 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.