DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and AgaP_AGAP003674

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_313455.4 Gene:AgaP_AGAP003674 / 1274348 VectorBaseID:AGAP003674 Length:314 Species:Anopheles gambiae


Alignment Length:284 Identity:61/284 - (21%)
Similarity:94/284 - (33%) Gaps:108/284 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 EGVCTNATAPSVSSINRILRNRAAERAAAEFARAASYGYAIHPTHPHPYTSFPTWPAHHPLWGAV 275
            ||:..|....:|||           .::.::|..|.|.|.::|                   |..
Mosquito   102 EGLIKNGHHITVSS-----------PSSLQYAAGALYSYPMYP-------------------GGH 136

  Fly   276 PLATPPGGGPAGAGGALQPGGSGSSYGSDGNMSSNPNSSNSNTTHSNGHNTNSGSGCGDSSAGSG 340
            .|..||..||.                       ||.|......|                    
Mosquito   137 VLRVPPQRGPC-----------------------NPLSWTLPPLH-------------------- 158

  Fly   341 RLSLPALSPDSGSRDSRSPDADANRMIDIEGEDSESQDSDQPKFRRNRTTFSPEQLDELEKEFDK 405
                ||.......:|..:....|.|:      ....|:...||.::.||:|:..|:.||||.|.|
Mosquito   159 ----PAALAHQAVKDRLAAFPIARRI------GHPYQNRTPPKRKKPRTSFTRIQVAELEKRFHK 213

  Fly   406 SHYPCVNTREKLAARTALSEARVQVWFSNRRAKWRRH------------QRVNLIKQRDS----- 453
            ..|.....|..||....:::|:|:.||.|||.||||.            .|:.|..|.::     
Mosquito   214 QKYLASAERAALARGLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQAANRLMLSLQAEALSKGF 278

  Fly   454 ---PSTSSSPTPLVNPVVSPVSPI 474
               |.::::|:     ..:|.:|:
Mosquito   279 GQPPPSAAAPS-----ATTPGAPL 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362 6/18 (33%)
Homeobox 388..440 CDD:278475 22/51 (43%)
AgaP_AGAP003674XP_313455.4 COG5576 143..270 CDD:227863 41/179 (23%)
Homeobox 195..248 CDD:278475 22/52 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.