DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and AgaP_AGAP010358

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_559100.2 Gene:AgaP_AGAP010358 / 1272681 VectorBaseID:AGAP010358 Length:314 Species:Anopheles gambiae


Alignment Length:454 Identity:124/454 - (27%)
Similarity:177/454 - (38%) Gaps:177/454 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 TPILT----QGAPPAAALGGIFCGGSAAAGPGAAAAAATNLNALASQH---RLLELSRFGLRGYD 148
            :||.:    ||......|||:|..|..                 ...|   |::|::..|:|...
Mosquito     9 SPIFSGYPFQGQGRVNQLGGVFINGRP-----------------LPNHIRLRIVEMAASGVRPCV 56

  Fly   149 LAQHMLSQQGAVSKLL------GTLRPPGLIGGSKPKVATPTVVSKIEQYKRENPTIFAWEIRER 207
            :::.:....|.|||:|      |::| ||:||||||:|:||.:.::||:.::.||.||:||||::
Mosquito    57 ISRQLRVSHGCVSKILNRYQETGSIR-PGVIGGSKPRVSTPEIEARIEELRKANPGIFSWEIRDK 120

  Fly   208 LITEGVCTNATAPSVSSINRILRNRAAERAAAEFARAASYGYAIHPTHPHPYTSFPTWPAHHPLW 272
            ||.:|:|...:|||||||:|:||                                          
Mosquito   121 LIKDGLCDKTSAPSVSSISRLLR------------------------------------------ 143

  Fly   273 GAVPLATPPGGGPAGAGGALQPGGSGSSYGSDGNMSSNPNSSNSNTTHSNGHNTNSGSGCGDSSA 337
                                  ||........||.|.|                           
Mosquito   144 ----------------------GGRREDVDLRGNHSIN--------------------------- 159

  Fly   338 GSGRLSLPALSPDSGSRDSRSPDADANRMIDIEGEDSESQDSD---QP------KFRRNRTTFSP 393
                                          .|.||.|..:|||   :|      |.||:||||:.
Mosquito   160 ------------------------------GILGESSCDEDSDTESEPGITLKRKQRRSRTTFNG 194

  Fly   394 EQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAKWRRHQRVNLIKQRDSPSTSS 458
            |||:.||..|.::.||.|.|||:||.:|.|:|||||||||||||:.|:|     :..:...:..:
Mosquito   195 EQLEALEIAFSRTQYPDVYTREELAQKTKLTEARVQVWFSNRRARLRKH-----MSSQQMVAFGA 254

  Fly   459 SPTPLVNPVVSPVSPIPVPVPVAVPESGQQKQPYPYSTSNMCNTSSSSSNSQPCNTINPGSKMS 522
            |..|      |........|..|...|| ...|....|.:.|.:||.:.    ..||:..|:.|
Mosquito   255 SQYP------SQFDQQAAAVAAATASSG-SGSPMGAGTWSQCYSSSPTQ----ATTIHAPSQSS 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362 45/104 (43%)
Homeobox 388..440 CDD:278475 33/51 (65%)
AgaP_AGAP010358XP_559100.2 PAX 19..144 CDD:238076 53/206 (26%)
Homeobox 188..241 CDD:278475 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.