DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and AgaP_AGAP010359

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_311581.3 Gene:AgaP_AGAP010359 / 1272680 VectorBaseID:AGAP010359 Length:172 Species:Anopheles gambiae


Alignment Length:282 Identity:91/282 - (32%)
Similarity:117/282 - (41%) Gaps:123/282 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 GAVSKLL------GTLRPPGLIGGSKPKVATPTVVSKIEQYKRENPTIFAWEIRERLITEGVCTN 216
            |.|||:|      |::| ||:|||||||||||.|.::||..|:.||.||:|||||:||.|||   
Mosquito     6 GCVSKILNRYQETGSIR-PGVIGGSKPKVATPEVEARIEDMKKMNPGIFSWEIREKLIKEGV--- 66

  Fly   217 ATAPSVSSINRILRNRAAERAAAEFARAASYGYAIHPTHPHPYTSFPTWPAHHPLWGAVPLATPP 281
            ...||||||:|:||                                                   
Mosquito    67 TDPPSVSSISRLLR--------------------------------------------------- 80

  Fly   282 GGGPAGAGGALQPGGSGSSYGSDGNMSSNPNSSNSNTTHSNGHNTNSGSGCGDSSAGSGRLSLPA 346
                   ||.:.||........|.::                |....|.| .|||          
Mosquito    81 -------GGGVDPGRKDDDGRKDYSI----------------HGILGGRG-SDSS---------- 111

  Fly   347 LSPDSGSRDSRSPDADANRMIDIEGEDSESQDSD--QPKFRRNRTTFSPEQLDELEKEFDKSHYP 409
                                      |:||:...  :.|.||:||||:.|||:.|||.|.::.||
Mosquito   112 --------------------------DTESEPGILLKRKQRRSRTTFTSEQLEALEKAFTRTQYP 150

  Fly   410 CVNTREKLAARTALSEARVQVW 431
            .|.|||:||:.|.|:|||:|||
Mosquito   151 DVYTREELASTTNLTEARIQVW 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362 45/77 (58%)
Homeobox 388..440 CDD:278475 27/44 (61%)
AgaP_AGAP010359XP_311581.3 HTH <1..80 CDD:304362 45/77 (58%)
Homeobox 128..172 CDD:278475 25/43 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.