Sequence 1: | NP_524041.2 | Gene: | toe / 39418 | FlyBaseID: | FBgn0036285 | Length: | 640 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_620605.1 | Gene: | Lhx5 / 124451 | RGDID: | 71079 | Length: | 402 | Species: | Rattus norvegicus |
Alignment Length: | 282 | Identity: | 65/282 - (23%) |
---|---|---|---|
Similarity: | 95/282 - (33%) | Gaps: | 109/282 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 327 NSGSGCGDSSAGSGRLSLPALSPDSGSRDSRSP-DADANRMIDIEGEDSESQDSDQPKFRRN-RT 389
Fly 390 TFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAKWRRHQRVNLIKQR--- 451
Fly 452 ------------------------------------------------DSPSTSSSPT------- 461
Fly 462 -------------PLVNP-----------VVSPVSPIPVP-VPVAVPE------SGQQKQPYPYS 495
Fly 496 TSNMCNTSSSSSNSQPCNTINP 517 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
toe | NP_524041.2 | HTH | 134..230 | CDD:304362 | |
Homeobox | 388..440 | CDD:278475 | 22/51 (43%) | ||
Lhx5 | NP_620605.1 | LIM1_Lhx1_Lhx5 | 5..56 | CDD:188753 | |
LIM2_Lhx1_Lhx5 | 64..119 | CDD:188761 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 124..186 | 18/64 (28%) | |||
Homeobox | 183..237 | CDD:395001 | 22/53 (42%) | ||
PHA03378 | <247..>392 | CDD:223065 | 22/152 (14%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 298..402 | 23/105 (22%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |