DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and Lhx5

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_620605.1 Gene:Lhx5 / 124451 RGDID:71079 Length:402 Species:Rattus norvegicus


Alignment Length:282 Identity:65/282 - (23%)
Similarity:95/282 - (33%) Gaps:109/282 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 NSGSGCGDSSAGSGRLSLPALSPDSGSRDSRSP-DADANRMIDIEGEDSESQDSDQPKFRRN-RT 389
            ||.|.|.|.|          ||||........| :.|.:...|.|..::|:::.:....||. ||
  Rat   131 NSVSSCTDRS----------LSPDLQDPLQDDPKETDNSTSSDKETANNENEEQNSGTKRRGPRT 185

  Fly   390 TFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAKWRRHQRVNLIKQR--- 451
            |...:||:.|:..|..:..|..:.||:||..|.|:...:||||.|||:|.||.::::.:..|   
  Rat   186 TIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHA 250

  Fly   452 ------------------------------------------------DSPSTSSSPT------- 461
                                                            ..||.:.||.       
  Rat   251 FFRSPRRMRPLGGRLDESEMLGSTPYTYYGDYQSDYYAPGGNYDFFAHGPPSQAQSPADSSFLAA 315

  Fly   462 -------------PLVNP-----------VVSPVSPIPVP-VPVAVPE------SGQQKQPYPYS 495
                         ||..|           :..|.:|.|.| :|.|:..      ||....|:|  
  Rat   316 SGPGSTPLGALEPPLAGPHGADNPRFTDMISHPDTPSPEPGLPGALHPMPGEVFSGGPSPPFP-- 378

  Fly   496 TSNMCNTSSSSSNSQPCNTINP 517
                  .|.:|..|.|.:..||
  Rat   379 ------MSGTSGYSGPLSHPNP 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 22/51 (43%)
Lhx5NP_620605.1 LIM1_Lhx1_Lhx5 5..56 CDD:188753
LIM2_Lhx1_Lhx5 64..119 CDD:188761
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..186 18/64 (28%)
Homeobox 183..237 CDD:395001 22/53 (42%)
PHA03378 <247..>392 CDD:223065 22/152 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 298..402 23/105 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.