DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and Phox2a

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_446321.2 Gene:Phox2a / 116648 RGDID:621323 Length:281 Species:Rattus norvegicus


Alignment Length:144 Identity:56/144 - (38%)
Similarity:74/144 - (51%) Gaps:38/144 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   380 DQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAKWRRHQR 444
            ::.|.||.||||:..||.|||:.|.::|||.:.|||:||.:..|:||||||||.|||||:|:.:|
  Rat    86 EKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQER 150

  Fly   445 VNLIK------------------QRDSPSTSSSPTP--------------LVNPVVSPVSPIPVP 477
            ....|                  ..||..::.||||              |.:|.:|| ||:|  
  Rat   151 AASAKGAAGATGAKKGEARCSSEDDDSKESTCSPTPDSTASLPPPPPAPSLASPRLSP-SPLP-- 212

  Fly   478 VPVAVPESGQQKQP 491
               |...||...||
  Rat   213 ---AALGSGPGPQP 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 32/51 (63%)
Phox2aNP_446321.2 Homeobox 94..147 CDD:395001 32/52 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..219 18/79 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.