DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and Rax

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_446130.1 Gene:Rax / 114213 RGDID:620371 Length:342 Species:Rattus norvegicus


Alignment Length:336 Identity:101/336 - (30%)
Similarity:134/336 - (39%) Gaps:105/336 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 PGGGPAGAGGAL--------QPGGSGSSYGS----------DGNMSSNPNSSNSNTTHSNGHNTN 327
            ||..||.|.|:.        .||||.|...|          ||.:.:.|...:|..:........
  Rat     4 PGCPPAMADGSFSLAGHLLRSPGGSTSRLHSIEAILGFTKEDGILDTFPAERSSRGSKERDPRLG 68

  Fly   328 SGSGCGDSSAGSGRLSLPALSPDSGSRDSRSPDADANRMI--DIEGE--------------DSES 376
            :.|.|..:.||....|.|| :|      ...|:.:|.|..  ..:||              ||:.
  Rat    69 ARSACPKAPAGGSESSPPA-AP------GLVPEFEATRPCYPKEQGEARPSPGLPVGPAAGDSKL 126

  Fly   377 QDSDQP---KFRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAK 438
            .:.::|   |.|||||||:..||.|||:.|:|||||.|.:||:||.:..|.|.||||||.|||||
  Rat   127 SEEEEPPKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAGKVNLPEVRVQVWFQNRRAK 191

  Fly   439 WRRHQR--VNLIKQRDSPSTSSSPTPLVNPVVSPVSPIPVPVPVAVPESGQQKQPYPYSTSNMCN 501
            |||.::  |:.:|.:|||..|.|.:|          |.....|:..|.||               
  Rat   192 WRRQEKLEVSSMKLQDSPLLSFSRSP----------PSSALAPLGGPGSG--------------- 231

  Fly   502 TSSSSSNSQPCNTINPGSKMSSKTSSVSSNQHMEEPAAAVATASPTASAPLSMGGENSAFRALPM 566
                   |.|     |||.:                     ...|....||. ||..:|.::||.
  Rat   232 -------SGP-----PGSAL---------------------PLEPWLGPPLP-GGGATALQSLPG 262

  Fly   567 TLPMPMTLPTA 577
            ..|....||.:
  Rat   263 FGPPGQGLPAS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 33/51 (65%)
RaxNP_446130.1 Octapeptide motif 33..40 1/6 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 49..141 21/98 (21%)
Homeobox 141..193 CDD:278475 33/51 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 209..295 25/124 (20%)
OAR 316..331 CDD:281777
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 319..332
Nuclear localization signal. /evidence=ECO:0000255 325..329
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.