DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and Nkx2-5

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_446103.2 Gene:Nkx2-5 / 114109 RGDID:620520 Length:319 Species:Rattus norvegicus


Alignment Length:407 Identity:81/407 - (19%)
Similarity:125/407 - (30%) Gaps:160/407 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 TPTVVSKIEQYKRENPTIFAWEIRERLITEGVCTNATAPSVSSINRILRNRA---AERAAAEFAR 243
            ||..|..|...:::..::.|.::..||       .||....|.:....:..|   .|.||...|.
  Rat    10 TPFSVKDILNLEQQQRSLAAGDLSARL-------EATLAPASCMLAAFKPEAYSGPEAAAPGLAE 67

  Fly   244 -AASYGYAIHPTHPHPYTSFPTWPAHHPLWGAVPLATPPGGGPAGAGGALQPGGSGSSYGSDGNM 307
             .|..|.|  |:.|....:|||.|..:|                            .:||     
  Rat    68 LRAELGPA--PSPPKCSPAFPTAPTFYP----------------------------RAYG----- 97

  Fly   308 SSNPNSSNSNTTHSNGHNTNSGSGCGDSSAGSGRLSLPALSPDSGSRDSRSPDADANRMI----D 368
                                                    .||    .::.|.||...:.    .
  Rat    98 ----------------------------------------DPD----PAKDPRADKKELCALQKA 118

  Fly   369 IEGEDSESQDSDQPKFRRN---RTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQV 430
            :|.:.:|:..:::|:.||.   |..||..|:.|||:.|.:..|.....|::||:...|:..:|::
  Rat   119 VELDKAETDGAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKI 183

  Fly   431 WFSNRRAKWRRHQRVNLIKQRDSPSTSSSPTPLVNPVVSPVSPIPVPV----------------- 478
            ||.|||.|.:|.::...::             |:.|...|...|.|||                 
  Rat   184 WFQNRRYKCKRQRQDQTLE-------------LLGPPPPPARRIAVPVLVRDGKPCLGDSAAYAP 235

  Fly   479 --PVAVPESGQQKQPYPYSTSNMCNTSSSSSNSQPCNTINPGSKMSSKTSSVSSNQHMEEPAAAV 541
              .|.:...|....|||......|:.:.|      |                         |||.
  Rat   236 AYGVGLNAYGYNAYPYPGYGGAACSPAYS------C-------------------------AAAY 269

  Fly   542 ATASPTASAPLSMGGEN 558
            ..|.|.|..|.:....|
  Rat   270 PAAPPAAQPPAAAANSN 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362 10/47 (21%)
Homeobox 388..440 CDD:278475 20/51 (39%)
Nkx2-5NP_446103.2 Homeobox 144..194 CDD:395001 19/49 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.