DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and Prrx2

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001099209.1 Gene:Prrx2 / 113931 RGDID:1311471 Length:248 Species:Rattus norvegicus


Alignment Length:293 Identity:83/293 - (28%)
Similarity:116/293 - (39%) Gaps:94/293 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 PPGGGPAGAGGALQPGGSGSSYGSDGNMSSNPNSSNSNTTHSNGHNTNSGSGCGDSSAGSGRLSL 344
            ||..||   |....||...              .:..|.:.|:..:....:..|..:||      
  Rat    12 PPAPGP---GPPPAPGDCA--------------QARKNFSVSHLLDLEEVAAAGRRAAG------ 53

  Fly   345 PALSPDSGSRDSRSPDADANRMIDIEGEDSESQDSD------------QPKFRRNRTTFSPEQLD 397
            |...|::....:|.|...::      |.::..||.:            :.|.|||||||:..||.
  Rat    54 PVPGPEAREGAAREPSGGSS------GSEAAPQDGECAAPGHGSATKRKKKQRRNRTTFNSSQLQ 112

  Fly   398 ELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAKWRRHQRVNL--------------- 447
            .||:.|:::|||....||:||.|..||||||||||.|||||:||::|..|               
  Rat   113 ALERVFERTHYPDAFVREELARRVNLSEARVQVWFQNRRAKFRRNERAMLATRSASLLKSYGQEA 177

  Fly   448 -IKQRDSP-STSSSPTPLVNPVVSPVSPIPVPVPVAVPESGQQKQPYPYSTSNMCNTSSSSSNSQ 510
             |:|..:| .|:.||..|..|..||.|.:|                 ||          |...|.
  Rat   178 AIEQPVAPRPTTLSPDYLSWPASSPYSSVP-----------------PY----------SPGGSS 215

  Fly   511 PCNTINPGSKMSSKTSSVS------SNQHMEEP 537
            |.   .||..|::..:|:.      |..|.:.|
  Rat   216 PA---TPGVNMANSIASLRLKAKEFSLHHSQVP 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 32/51 (63%)
Prrx2NP_001099209.1 Homeobox 104..156 CDD:395001 31/51 (61%)
COG5576 <110..214 CDD:227863 47/130 (36%)
OAR 222..238 CDD:397759 2/15 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.