DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and Hoxc11

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001020013.1 Gene:Hoxc11 / 109663 MGIID:96193 Length:304 Species:Mus musculus


Alignment Length:218 Identity:53/218 - (24%)
Similarity:83/218 - (38%) Gaps:58/218 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 SYGYAIHPTHPHP-----YTS----------FPTWPAHHPLWGAVPLATPPGGGPAGAGGALQ-P 294
            |||...||:.||.     |:|          |..:..:....|....|.||..|...|.|..: |
Mouse   120 SYGGHHHPSAPHAAPAGFYSSVNKNSVLPQAFDRFFDNAYCGGGDAPAEPPCSGKGEAKGEPEAP 184

  Fly   295 GGSGSSYGSDGNMSSNPNSSNSNTTHSNGHNTNSGSGCGDSSAGSGRLSLPALSPDSGSRDSRSP 359
            ..||.:..::....:.....|:|                .||:||...:  ...|..|:    :|
Mouse   185 PASGLASRAEAGAEAEAEEENTN----------------PSSSGSSHSA--TKEPAKGA----AP 227

  Fly   360 DADANRMIDIEGEDSESQDSDQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALS 424
            :|                    |:.|:.|..:|..|:.|||:||..:.|.....|.:|:....|:
Mouse   228 NA--------------------PRTRKKRCPYSKFQIRELEREFFFNVYINKEKRLQLSRMLNLT 272

  Fly   425 EARVQVWFSNRRAKWRRHQRVNL 447
            :.:|::||.|||.|.::..|..|
Mouse   273 DRQVKIWFQNRRMKEKKLSRDRL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 19/51 (37%)
Hoxc11NP_001020013.1 DUF3528 42..178 CDD:403310 15/57 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..237 21/111 (19%)
Homeobox 235..289 CDD:395001 19/53 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.