DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and Cphx1

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_780551.1 Gene:Cphx1 / 105594 MGIID:2145733 Length:182 Species:Mus musculus


Alignment Length:247 Identity:53/247 - (21%)
Similarity:82/247 - (33%) Gaps:91/247 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   358 SPDADANRMIDIEGEDSESQDSDQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTA 422
            :|:...||        |:::.....:..:.|..||.::|..|::||..:.||...|:::||.:..
Mouse     9 APETKDNR--------SKARKRYGSRNSKPRHKFSRDELKRLKQEFAYAPYPDFTTKDELARQFQ 65

  Fly   423 LSEARVQVWFSNRRAK-----------WRRHQRVNLIKQRDSPSTSSSPTPLVNPVVSPVSPIPV 476
            ...:.:..||.|:||:           .||.:|.     :|...|....|          .|   
Mouse    66 CEVSVIDNWFQNKRARLAPELKSKISAMRRMRRC-----QDYMRTGHQDT----------QP--- 112

  Fly   477 PVPVAVPESGQQKQPYPYSTSNMCNTSSSSSNSQPCNTINPGSKMSSKTSSVSSNQHMEEPAAAV 541
              |.|   ||:|     ||:   |::...|...|...|:                   |...|| 
Mouse   113 --PKA---SGEQ-----YSS---CDSVVRSIGRQSIGTV-------------------EHQGAA- 144

  Fly   542 ATASPTASAPLSMGGENSAFRALPMTLP-------MPMTLPTASAAAFALSF 586
                          |..|:||....|.|       |...|.|.....|..|:
Mouse   145 --------------GRESSFRPTNFTFPPVYEQYYMGDQLETQETQYFTFSY 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 17/62 (27%)
Cphx1NP_780551.1 homeodomain 29..82 CDD:238039 17/52 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.