Sequence 1: | NP_524041.2 | Gene: | toe / 39418 | FlyBaseID: | FBgn0036285 | Length: | 640 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001342542.1 | Gene: | CPHXL / 105371346 | HGNCID: | 51815 | Length: | 405 | Species: | Homo sapiens |
Alignment Length: | 280 | Identity: | 56/280 - (20%) |
---|---|---|---|
Similarity: | 101/280 - (36%) | Gaps: | 70/280 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 370 EGEDSESQDSDQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSN 434
Fly 435 RRAKW---RRHQRVNLIKQRDSPSTSSSPTPLVNPVVSPVSPIPVPVPVAVPE--SGQQK----- 489
Fly 490 -------------QPYPYSTSNMCNTSSSSSNSQP------------------CNTIN----PGS 519
Fly 520 KMSSKTSSVSSNQHMEEPAAAVATASPTASAPLSMGGENSAFRALPMTL-----PMPMTLP---- 575
Fly 576 -------TASAAAFALSFAR 588 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
toe | NP_524041.2 | HTH | 134..230 | CDD:304362 | |
Homeobox | 388..440 | CDD:278475 | 19/54 (35%) | ||
CPHXL | NP_001342542.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..33 | 2/18 (11%) | |
HOX | 28..82 | CDD:197696 | 18/53 (34%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 340..363 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |