DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and CPHXL

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001342542.1 Gene:CPHXL / 105371346 HGNCID:51815 Length:405 Species:Homo sapiens


Alignment Length:280 Identity:56/280 - (20%)
Similarity:101/280 - (36%) Gaps:70/280 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 EGEDSESQDSDQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSN 434
            |...:|.:.:...:..::|..||.|.|.||::.|.::.||...||:.||.:.......:..||.|
Human    14 EDHHNEERQTKNKRKTKHRHKFSEELLQELKEIFGENCYPDYTTRKTLAIKFDCPVNVIDNWFQN 78

  Fly   435 RRAKW---RRHQRVNLIKQRDSPSTSSSPTPLVNPVVSPVSPIPVPVPVAVPE--SGQQK----- 489
            :||:.   .|.:...|.|:.|.|..:.|       .:|...........|..:  ||.|:     
Human    79 KRARLPPAERRRIFVLQKKHDFPVQAHS-------FLSCQETQAAAHNYATKQSLSGAQRALMRR 136

  Fly   490 -------------QPYPYSTSNMCNTSSSSSNSQP------------------CNTIN----PGS 519
                         |...|:..::.|..:.|....|                  |:.:.    |..
Human   137 AGCSHLEKQWIPSQEMGYNCFSLENQETPSQQVGPQCSYLEKPGIPSQQVGSQCSYLEKLGIPSQ 201

  Fly   520 KMSSKTSSVSSNQHMEEPAAAVATASPTASAPLSMGGENSAFRALPMTL-----PMPMTLP---- 575
            :::|::|.:.:... :.|..|:.....|.|.. |..|.::|:..|....     |.|.::|    
Human   202 QVASQSSYLVTGTE-KHPGCAMGYGGDTGSGH-SGSGHSTAYHFLSYNSAECLHPPPSSVPYFHG 264

  Fly   576 -------TASAAAFALSFAR 588
                   :..|:.|.|.:|:
Human   265 ERTETKESQHASPFLLDYAQ 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 19/54 (35%)
CPHXLNP_001342542.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33 2/18 (11%)
HOX 28..82 CDD:197696 18/53 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 340..363
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.