DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and LOC101734831

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_004919129.1 Gene:LOC101734831 / 101734831 -ID:- Length:191 Species:Xenopus tropicalis


Alignment Length:207 Identity:51/207 - (24%)
Similarity:73/207 - (35%) Gaps:62/207 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 YTSFPTWPAHHPLWGAVPLATPP-GGGPAGAGGALQPGGS-------------GSSYGSDGNMSS 309
            ||:. |....:|:     ||.|| ...|:|....|.|...             |.|.|.....:.
 Frog    12 YTAL-TLQDDYPM-----LAPPPRNHNPSGMFHDLNPTQEKLQEALMELYSVLGFSQGPPMTRTL 70

  Fly   310 NPNSSNSNT-THSNGHNTNSGSGCGDSSAGSGRLSLPALSPDSGSRDSRSPDADANRMIDIEGED 373
            ....:.||| |.|:|.:|.                         .:....|.....|.:    .:
 Frog    71 RNGGAESNTETPSSGISTK-------------------------YQVYYQPTKSCKRPL----YE 106

  Fly   374 SESQDSDQPKFR------------RNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEA 426
            .|.:.|.:|:.:            |.||.:|.||...|..:||.:.||....|..:|..|.:.|.
 Frog   107 EEQRASKKPRIQIDDHLPTANTRCRKRTIYSKEQTIFLHNQFDLNPYPDFVGRCHIAKVTGIPEP 171

  Fly   427 RVQVWFSNRRAK 438
            |:||||.||||:
 Frog   172 RIQVWFQNRRAR 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 23/51 (45%)
LOC101734831XP_004919129.1 HOX 131..184 CDD:197696 24/53 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.