DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and Hoxc11

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_038934166.1 Gene:Hoxc11 / 100911859 RGDID:6489991 Length:329 Species:Rattus norvegicus


Alignment Length:189 Identity:47/189 - (24%)
Similarity:70/189 - (37%) Gaps:54/189 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 SYGYAIHPTHPHP-----YTS----------FPTWPAHHPLWGAVPLATPPGGGPAGAGGALQ-P 294
            |||...||:.||.     |:|          |..:..:....|....|.||..|...|.|..: |
  Rat   120 SYGGHHHPSAPHAAPAGFYSSVNKNSVLPQAFDRFFDNAYCGGGDAPAEPPCSGKGEAKGEPEAP 184

  Fly   295 GGSGSSYGSDGNMSS-----NPNSSNSNTTHSNGHNTNSGSGCGDSSAGSGR-----LSLPALS- 348
            ..||.:..::....:     |.|.|:|.::||.......|      :|.|.|     .:||... 
  Rat   185 PASGLASRAEAGAEAEAEEENTNPSSSGSSHSATKEPAKG------AAPSRRPPNPQEALPLFEI 243

  Fly   349 PDSGS------------RDSRS--PDADANRMIDIEGEDSESQDSDQPKFRRNRTTFSP 393
            ||.|:            |::.:  |.|:.:|      ..||:..|:| |..|.:|...|
  Rat   244 PDPGTGARVFLQRVHQQREAAAAVPHAEPDR------PTSENLVSEQ-KNERKKTEQRP 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 2/6 (33%)
Hoxc11XP_038934166.1 DUF3528 42..178 CDD:403310 15/57 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.