DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and LOC100911668

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_006257771.1 Gene:LOC100911668 / 100911668 RGDID:6491746 Length:413 Species:Rattus norvegicus


Alignment Length:509 Identity:108/509 - (21%)
Similarity:151/509 - (29%) Gaps:190/509 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LPGAAPAIPATATAGSQSPGAIMPMAAVPLPSHL--QLL----------GSSAGGVG-------- 64
            ||  :|..|.|.:. |:||.|         .|.|  .|:          |.||||.|        
  Rat     9 LP--SPNYPTTMSC-SESPAA---------NSFLVDSLISSGRGEAGGGGGSAGGGGGGYYAHGG 61

  Fly    65 ---QPAAITPVSPTAATTVLAQPHSLSPSTPILTQGAPPAAALGGIFCGGSAAAGPGAAAAAATN 126
               .||:..|..        .|...|.|:.......||.....||   ||....||||...|...
  Rat    62 VYLPPASDLPYG--------LQSCGLFPALGNKRNEAPSPGGGGG---GGGGGLGPGAHGYAPAP 115

  Fly   127 LNALASQHRLLELSRFGLRGYDLAQHMLSQQGAVSKLLGTLRPPGLIGGSKPKVATPTVVSKIEQ 191
            |:......|...                            :.||   .|..|....|      :|
  Rat   116 LDLWLDAPRSCR----------------------------MEPP---DGPPPPQPQP------QQ 143

  Fly   192 YKRENP--------------TIFAWEIRERLITEGVCTNATA---PSVSSINRILRNRAAERAAA 239
            .::..|              ..||..|:|.   ...|...:|   |..|             |||
  Rat   144 QQQPPPPPPQPPQPPPQATSCSFAQNIKEE---SSYCLYDSADKCPKGS-------------AAA 192

  Fly   240 EFARAASYGYAIHPTHPHPYTSFPTWPAHHPLWGAVPLATPPGGGPAGA-GGALQPG-------- 295
            :.|                  .||..|             ||.|...|| .|...||        
  Rat   193 DLA------------------PFPRGP-------------PPDGCALGASSGVPVPGYFRLSQAY 226

  Fly   296 GSGSSYGSDGNMS--------------SNPNSSNSNTTHSNGHN-------------TNSGSGCG 333
            |:...:||.|...              ..|::..|.:..:.|..             ...||...
  Rat   227 GTAKGFGSGGTQQLASPFPAQPPGRGFDPPSALASGSAEAAGKERVLDSTPPPTLVCAGGGSSQA 291

  Fly   334 DSSAGSGRLSLPALSPDSGSRDSRSPDADANRMIDIEGEDSESQDS--DQPKFRRNRTTFSPEQL 396
            |..|.:...:...|||........||:.|:     :....||:..:  .....|:.|..::..|.
  Rat   292 DEEAHASSSAAEELSPAPSENSKASPEKDS-----LGNSKSENAANWLTAKSGRKKRCPYTKHQT 351

  Fly   397 DELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAKWRRHQRVNLIKQ 450
            .||||||..:.|.....|.:::....|::.:|::||.|||.|.::..|.|.|::
  Rat   352 LELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRE 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362 16/112 (14%)
Homeobox 388..440 CDD:278475 18/51 (35%)
LOC100911668XP_006257771.1 Homeobox 342..395 CDD:278475 18/52 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.