Sequence 1: | NP_524041.2 | Gene: | toe / 39418 | FlyBaseID: | FBgn0036285 | Length: | 640 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_004915967.1 | Gene: | drgx / 100493837 | XenbaseID: | XB-GENE-993712 | Length: | 263 | Species: | Xenopus tropicalis |
Alignment Length: | 233 | Identity: | 75/233 - (32%) |
---|---|---|---|
Similarity: | 111/233 - (47%) | Gaps: | 47/233 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 371 GEDSESQDSD---QPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWF 432
Fly 433 SNRRAKWRRHQRVNLIKQ---RDSPSTSS-----SPTPLVNP--------------------VVS 469
Fly 470 PVSPIPVPVPVAVPESGQQKQPYPYSTSNMCNTSSSSSNSQP--CNTINPGSKMSSKTSSVS--- 529
Fly 530 --SNQHMEE--------PAAAVATASPTASAPLSMGGE 557 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
toe | NP_524041.2 | HTH | 134..230 | CDD:304362 | |
Homeobox | 388..440 | CDD:278475 | 32/51 (63%) | ||
drgx | XP_004915967.1 | Homeobox | 38..91 | CDD:395001 | 33/52 (63%) |
OAR | 204..220 | CDD:397759 | 4/15 (27%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000011 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |