DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and drgx

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_004915967.1 Gene:drgx / 100493837 XenbaseID:XB-GENE-993712 Length:263 Species:Xenopus tropicalis


Alignment Length:233 Identity:75/233 - (32%)
Similarity:111/233 - (47%) Gaps:47/233 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 GEDSESQDSD---QPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWF 432
            |..:.|:..|   :.|.|||||||:.:||:.||..|.::|||.|.|||:||.:..|:||||||||
 Frog    18 GAHAASEFDDGFLRRKQRRNRTTFTLQQLEALEAVFAQTHYPDVFTREELAMKINLTEARVQVWF 82

  Fly   433 SNRRAKWRRHQRVNLIKQ---RDSPSTSS-----SPTPLVNP--------------------VVS 469
            .|||||||:.:|.:..::   ..:|..::     ||:..|.|                    |.|
 Frog    83 QNRRAKWRKTERGSCEQEGAKESAPEVTTAGRNLSPSSTVEPVRGKKETLEAQQRCLSHDRAVGS 147

  Fly   470 PVSPIPVPVPVAVPESGQQKQPYPYSTSNMCNTSSSSSNSQP--CNTINPGSKMSSKTSSVS--- 529
            ..|..|..:|.|:..:....|...:..|...:...|...|.|  .:.:.|....|.:|:||:   
 Frog   148 ATSFFPSCLPGALLNTASYAQALSHVASLKGSPLCSCCVSDPLGLSFLPPYGCQSHRTASVAALR 212

  Fly   530 --SNQHMEE--------PAAAVATASPTASAPLSMGGE 557
              :.:|.|.        |:|..:|.: :|||||..|.|
 Frog   213 MKAREHSEAVLQSAQLLPSAGNSTGA-SASAPLEGGHE 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 32/51 (63%)
drgxXP_004915967.1 Homeobox 38..91 CDD:395001 33/52 (63%)
OAR 204..220 CDD:397759 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.