powered by:
Protein Alignment toe and med9
DIOPT Version :9
Sequence 1: | NP_524041.2 |
Gene: | toe / 39418 |
FlyBaseID: | FBgn0036285 |
Length: | 640 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_004918128.1 |
Gene: | med9 / 100485886 |
XenbaseID: | XB-GENE-987612 |
Length: | 114 |
Species: | Xenopus tropicalis |
Alignment Length: | 46 |
Identity: | 14/46 - (30%) |
Similarity: | 21/46 - (45%) |
Gaps: | 9/46 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 595 MGTPLNLGHGSSPIQAQSGRDHQSEEREYEDEQEEEE--VINVEHD 638
|.|..|:.....| :.:.||.|..:|:|||| .:.:.||
Frog 1 MATGGNVRPAEEP-------EEEEEEDEAAEEEEEEEYTFLPLVHD 39
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
toe | NP_524041.2 |
HTH |
134..230 |
CDD:304362 |
|
Homeobox |
388..440 |
CDD:278475 |
|
med9 | XP_004918128.1 |
Med9 |
32..106 |
CDD:369417 |
2/8 (25%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.