DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and Hoxb2

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_002727852.1 Gene:Hoxb2 / 100361765 RGDID:2319509 Length:355 Species:Rattus norvegicus


Alignment Length:370 Identity:92/370 - (24%)
Similarity:128/370 - (34%) Gaps:92/370 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 IHPTHPHPYTSFPTWPAHHPLWGAVPLATPPGGGPAGAGGALQP------GGSGSSYGSDGNMSS 309
            |.|..|....:||:...     ||..|..|....|||.|.||:|      ......:.......|
  Rat    43 IPPPPPPLEQTFPSLQL-----GASTLQRPGSQKPAGDGPALRPPPPLPVAPPAPEFPWMKEKKS 102

  Fly   310 NPNSSNSNTTHSNGHNTNSGSGCGDSSAGSGRLSLPALSPDSGSRDSRSPDADANRMIDIEGEDS 374
            ....|.|..|.|...::...||.|..|.|.|       .|:||...|                  
  Rat   103 AKKPSQSAATPSPAASSVRASGVGSPSDGPG-------LPESGGSGS------------------ 142

  Fly   375 ESQDSDQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAKW 439
                      ||.||.::..||.||||||..:.|.|...|.::||...|:|.:|:|||.|||.|.
  Rat   143 ----------RRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKH 197

  Fly   440 RRHQRVNLIKQRDSP--------STSSSPTPLVNPVVSP--VSPIPVPVPVAVPESGQQ-----K 489
            :|.     .:.|:.|        :...:..|...|.|||  |:...:.....:|....|     .
  Rat   198 KRQ-----TQHREPPDGEPGGLSAQDDAGEPAEEPTVSPGDVASHRLREACFLPAEAAQGPRGAP 257

  Fly   490 QPYPYSTSNMCNTSSSSSNSQPCNTINPGSKMSSKTSSVSSNQHMEEPAAAVATASP-------- 546
            .|.|.:|:    ..|..::|..|..:..|...|         :.:.|.|......||        
  Rat   258 PPLPPATA----LESVGASSPGCTMLRAGGLQS---------EPLPEDACPERQDSPFLPDLNFF 309

  Fly   547 TASAPLSMGGENSAFRALPMTLPMP-----MTLPTASAAAFALSF 586
            .|.:.|.|.|..|......:..|:|     :...|::..|..|.|
  Rat   310 AADSCLPMSGGLSPSLQGSLDSPVPFSEEELDFFTSTLCAIDLQF 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 25/51 (49%)
Hoxb2XP_002727852.1 Homeobox 146..198 CDD:278475 25/51 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.