DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and arxb

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_002667096.1 Gene:arxb / 100329907 ZFINID:ZDB-GENE-121109-2 Length:385 Species:Danio rerio


Alignment Length:322 Identity:90/322 - (27%)
Similarity:128/322 - (39%) Gaps:74/322 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 CTNATAPSVSSINRILRNRAAERAAAEFARAASYGYAIHPTHPHPYTSFPTWPAHHPLWGAVPLA 278
            |...|..|...|:.||..::.       .:.....:::.|.|||.:  .|. ....|.......:
Zfish    17 CKTPTLLSSYCIDSILGRKSP-------LKVQETPHSLWPLHPHMH--LPP-KLRRPFAPLTDSS 71

  Fly   279 TPPGGGPAGAGGALQPGGSGSSYGSDGNMSSNPNSSNSNTTHSNGHNT--NSGSG---CGDSSA- 337
            |....||.    .||.............:  |.:.:.|...|::..||  |...|   ||:::. 
Zfish    72 TDETAGPR----LLQTACEKLKITEASIV--NISRAGSYQEHASCKNTPINEEEGADICGETNVT 130

  Fly   338 ----------GSGRLSLPALSPDSGSRDSRSPDADANRMIDIEGEDSESQDSDQPKFRRNRTTFS 392
                      .|...||.|                        |.|:| ....:.|.||.||||:
Zfish   131 LKQEREAFLKNSEETSLSA------------------------GSDTE-DGMLKRKQRRYRTTFT 170

  Fly   393 PEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAKWRRHQRVNLIKQRDSPSTS 457
            ..||:|||:.|.|:|||.|.|||:||.|..|:||||||||.|||||||:.::|.:.....|...|
Zfish   171 SYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREKVGVQPHTLSLHYS 235

  Fly   458 SSPTPLVNPVVSPVSPIP-VPVPVAVPESGQQKQPYPYSTSNMCNTSSSSSNSQPC-NTINP 517
            .:| |....:...:|..| ||.|....:|.   .|.|:...           :||. |:::|
Zfish   236 GAP-PAAQSLCHYLSGNPFVPNPHPAIDSA---WPAPFQRL-----------AQPAQNSVSP 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362 5/15 (33%)
Homeobox 388..440 CDD:278475 35/51 (69%)
arxbXP_002667096.1 Homeobox 166..218 CDD:278475 35/51 (69%)
OAR 351..368 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.