DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and pou5f3.3

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001123836.1 Gene:pou5f3.3 / 100170593 XenbaseID:XB-GENE-5903504 Length:423 Species:Xenopus tropicalis


Alignment Length:281 Identity:59/281 - (20%)
Similarity:92/281 - (32%) Gaps:77/281 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 PYTSFPTWPAHHPLWGAVPLATPPGGGPAGAGGALQPGGSGSSYGSDGNMSSNPNSSNSNTTH-- 320
            |..:.|..|::...|...|....|.|...|......|.|......||.:.:::..|..|||..  
 Frog   114 PSPNSPMVPSYAQYWHHAPWQGNPTGQALGLPSRAHPDGGEKPQQSDCSPTASLESGASNTEDEE 178

  Fly   321 -SNGHNTNSGSG-CGDS----SAGSG---------------------RLSLPALSPDSG------ 352
             |:..::.:..| |..|    |.|||                     |::|.....|.|      
 Frog   179 VSSALSSRAERGLCSPSPNNASFGSGNEEDGTTLEEMEEFAKELKQKRVALGYTQGDIGHALGIL 243

  Fly   353 -----SRDS----RSPDADANRMIDI---------EGEDSE--------SQDSDQPKFRRNRTTF 391
                 |:.:    .|.......|..:         |.|:::        :|..:|.:.|:.||.|
 Frog   244 YGKMFSQTTICRFESLQLTFKNMCKLKPLLEQWLGEAENNDNLQEMIHKAQLEEQNRKRKMRTCF 308

  Fly   392 SPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAKWRRHQRVNLIKQRDSPST 456
            .......||..|..:..|......::|....|.:..|:|||.|||.|.:...|::          
 Frog   309 DSVLKGRLEGHFMCNQKPGARELAEIAKELGLEKDVVRVWFCNRRQKEKSKSRMS---------- 363

  Fly   457 SSSPTPLVNPVVSPVSPIPVP 477
                  ..:..|...||:|.|
 Frog   364 ------KAHEFVGGASPVPSP 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 17/51 (33%)
pou5f3.3NP_001123836.1 PTZ00395 <7..>177 CDD:185594 16/62 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..211 24/96 (25%)
POU 207..281 CDD:197673 8/73 (11%)
Homeobox 305..357 CDD:365835 17/51 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.