Sequence 1: | NP_524041.2 | Gene: | toe / 39418 | FlyBaseID: | FBgn0036285 | Length: | 640 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571635.2 | Gene: | mxtx1 / 100149566 | ZFINID: | ZDB-GENE-000710-7 | Length: | 309 | Species: | Danio rerio |
Alignment Length: | 304 | Identity: | 66/304 - (21%) |
---|---|---|---|
Similarity: | 103/304 - (33%) | Gaps: | 123/304 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 367 IDIEGEDSESQDSDQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVW 431
Fly 432 FSNRRAK-----------WRR---------------HQRVN------------------LIKQR- 451
Fly 452 --------DSPSTSS----------------------SPTPLVNPV-------------VSPVSP 473
Fly 474 IPVPVPVAVPESGQQKQPYPYSTSNMCNTSSSSSNSQPCNTINPGSKMSSKT----SSVSSNQHM 534
Fly 535 EEPAAAVATASPTASAPLSMGGENSAFRALPMTLPMPMTLPTAS 578 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
toe | NP_524041.2 | HTH | 134..230 | CDD:304362 | |
Homeobox | 388..440 | CDD:278475 | 24/62 (39%) | ||
mxtx1 | NP_571635.2 | HOX | 24..78 | CDD:197696 | 25/53 (47%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0849 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000011 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |