DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and mxtx1

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_571635.2 Gene:mxtx1 / 100149566 ZFINID:ZDB-GENE-000710-7 Length:309 Species:Danio rerio


Alignment Length:304 Identity:66/304 - (21%)
Similarity:103/304 - (33%) Gaps:123/304 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 IDIEGEDSESQDSDQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVW 431
            ||...:.|.|....:...||.||:||.|.::.|...|:...||.::.||.|:..|.|.|:|:|||
Zfish     7 IDATAKTSGSGAVSRSASRRKRTSFSKEHVELLRATFETDPYPGISLRESLSQTTGLPESRIQVW 71

  Fly   432 FSNRRAK-----------WRR---------------HQRVN------------------LIKQR- 451
            |.||||:           |:.               |::.|                  .||:. 
Zfish    72 FQNRRARTLKCKGGKKPLWQTDLPAYNNMQTSPMQIHRKNNESSGATGTLCSPPPAYPDRIKEEM 136

  Fly   452 --------DSPSTSS----------------------SPTPLVNPV-------------VSPVSP 473
                    |:||:.|                      ||:||::|.             .||:| 
Zfish   137 EKDAVCGCDTPSSMSISDDSGYCTPSYHQSRAIQSHMSPSPLLSPEHQMPPNWGVRYGRRSPMS- 200

  Fly   474 IPVPVPVAVPESGQQKQPYPYSTSNMCNTSSSSSNSQPCNTINPGSKMSSKT----SSVSSNQHM 534
                         ....|| :..:..||.....|:|:..||:.|.:.::..:    :.:.....:
Zfish   201 -------------SMWSPY-HLEAYACNPGFFYSHSEKHNTLQPLTPVTPDSGCWEAGLDRTSPV 251

  Fly   535 EEPAAAVATASPTASAPLSMGGENSAFRALPMTLPMPMTLPTAS 578
            :.|..      |.....|..|..:.         |:| .|||.|
Zfish   252 DNPDV------PRTEGQLESGVHHG---------PLP-ELPTLS 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 24/62 (39%)
mxtx1NP_571635.2 HOX 24..78 CDD:197696 25/53 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.