DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and rax

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_002936715.1 Gene:rax / 100038124 XenbaseID:XB-GENE-492665 Length:326 Species:Xenopus tropicalis


Alignment Length:278 Identity:91/278 - (32%)
Similarity:118/278 - (42%) Gaps:55/278 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 LATPPGGGP-------AGAGGALQPG--GSGSSYGSDGNMSSNPNSSN-------SNTTHSNGHN 325
            |...|||.|       |..|.:.:..  ||..:..|..|.......|:       :...|....:
 Frog    20 LLRSPGGNPSRLHSIEAILGFSKEDSVLGSFQTEVSPRNAKEVDKRSSRHCLHKMTEEIHPQQEH 84

  Fly   326 TNSGSGCGDSSAGSGRLSLPALSPDSGSRDSRSPDADANRMIDIEGEDSESQDSDQP--KFRRNR 388
            ...|...|.....||:.|...|||  |...|.:.|   |::         |.|..||  |.||||
 Frog    85 LEDGQSDGYGDPYSGKTSSECLSP--GLSTSNNSD---NKL---------SDDEQQPKKKHRRNR 135

  Fly   389 TTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAKWRRHQR--VNLIKQR 451
            |||:..||.|||:.|:|||||.|.:||:||.:..|.|.||||||.||||||||.::  |..:|.:
 Frog   136 TTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKLEVTSMKLQ 200

  Fly   452 DSP--STSSSPTPLVNPVVSPVSPI---------------PVPVPVAVPESGQQKQPYPYSTSNM 499
            |||  |.:.||.|.....:|...|:               .:|..|..|.|    .|..|:....
 Frog   201 DSPILSFNRSPQPSAMSAISSSLPLDSWLTPSISNSTALQSLPGFVTSPPS----LPGSYTPPPF 261

  Fly   500 CNTSSSSSNSQPCNTINP 517
            .|.:|.....||...:.|
 Frog   262 INPASVGHALQPLGAMGP 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 33/51 (65%)
raxXP_002936715.1 Homeobox 135..188 CDD:365835 34/52 (65%)
OAR 299..315 CDD:367680
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.