DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and DUXB

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001338236.1 Gene:DUXB / 100033411 HGNCID:33345 Length:345 Species:Homo sapiens


Alignment Length:335 Identity:71/335 - (21%)
Similarity:126/335 - (37%) Gaps:107/335 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   349 PDSGSRDSRS-----PDAD----------ANRMIDIE--GEDSESQDSDQ---------PKFRRN 387
            ||..:|:..:     |:::          ..|.:|.:  .|..::|..||         ||..|.
Human    40 PDKAAREQLAKEIGVPESNIQVWFKNYRVKQRKLDYKCFSEKDQTQGHDQSQHLTQEYLPKEARQ 104

  Fly   388 RTTF-SPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRA---KWRRHQRVNLI 448
            :.|| :..|.:.|.:.|:::.:|.:.||:|||.:|.|.|:|:|:||..:|:   |..|.:.:||:
Human   105 KQTFITWTQKNRLVQAFERNPFPDIATRKKLAEQTGLQESRIQMWFQKQRSLYLKKSRMEPMNLL 169

  Fly   449 KQRDSPSTSSSPTPLVNPVVSPVSPIPVPVPVAVPESGQQKQPYPYSTSNMCNTSSSSSNSQPCN 513
            .  |.|:.....|...:|:                     ....|..:|:..:.|.|||..:...
Human   170 V--DDPNERPDATVGWHPI---------------------NLFLPTDSSHYFSCSHSSSGHETLP 211

  Fly   514 TINPGSKMSSKT----SSVSSNQHMEEPAAAVATASPTASAPLSMGGENSAFRALPMTLPMP-MT 573
            .:.|.::.....    .|...|..:.:|..||            ..||.|   ..|:.:|.. :|
Human   212 PVLPSTQAPWDPFRFHVSQGPNVMIMQPTQAV------------QEGEKS---DQPLIIPNHLLT 261

  Fly   574 LPTASAAAFALSFARQYIAKYMGTPLNLGHGSSPIQAQSGRDHQSEER-------------EYED 625
            ||              .:.|.:.||       :|...|...:||:.:.             :.|.
Human   262 LP--------------ILTKDLDTP-------TPFWLQYQEEHQNHKEHSGSGVPQVKSHSQPEP 305

  Fly   626 EQEEEEVINV 635
            |..|::.:|:
Human   306 EHREQQPLNL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 20/55 (36%)
DUXBNP_001338236.1 homeodomain 16..72 CDD:238039 4/31 (13%)
homeodomain 103..161 CDD:238039 21/57 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 282..314 5/31 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.