DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toe and alx4a

DIOPT Version :9

Sequence 1:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_001340966.1 Gene:alx4a / 100006399 ZFINID:ZDB-GENE-070712-3 Length:368 Species:Danio rerio


Alignment Length:287 Identity:90/287 - (31%)
Similarity:132/287 - (45%) Gaps:65/287 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 PNSSNSNTTHSNGHNTNSGSGCGDSSAGSGRLSLPALSPDSGS-------RDS--RSPDADANRM 366
            |..|:.....::|||....:..|..|.|.....||..|..:|.       :||  :||....:.:
Zfish    95 PPDSSKLQQENSGHNGGLIACYGKDSTGLTDSELPQNSDPAGMDGSYLSVKDSGVKSPQQATSEL 159

  Fly   367 ID----IEGEDSESQDSDQPKFRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEAR 427
            ..    .|||      |::.|.|||||||:..||:||||.|.|:|||.|..||:||.||.|:|||
Zfish   160 ASPLDKTEGE------SNKGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLALRTDLTEAR 218

  Fly   428 VQVWFSNRRAKWRRHQRVNLIKQRDSPSTSSSPTPLV----------NPV----VSPVSPIP--- 475
            |||||.|||||||:.:|...::|..:..:::...||:          ||.    .|..||:|   
Zfish   219 VQVWFQNRRAKWRKRERFGQMQQVRTHFSTAYELPLLTRPENYAQIQNPSWIGGSSAASPVPGCV 283

  Fly   476 VP---VPVAVPESGQQKQPYPYSTSNMCNTSSSSSNSQPCNTINPGSKMSS-------------- 523
            ||   |...:|       |:|::.|.:.:.....|........:.||...|              
Zfish   284 VPCDSVTSCMP-------PHPHAASGVSDFLGVPSPGSHMGQTHMGSLFGSPGMGTGINGYDLNM 341

  Fly   524 ----KTSSVSS-NQHMEEPAAAVATAS 545
                |:||::: ....:|.:||::.|:
Zfish   342 DPDRKSSSIAALRMKAKEHSAAISWAT 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 36/51 (71%)
alx4aXP_001340966.1 Homeobox 179..231 CDD:278475 36/51 (71%)
OAR 344..361 CDD:281777 4/16 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.