DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP1 and SPS18

DIOPT Version :9

Sequence 1:NP_524040.2 Gene:ArfGAP1 / 39417 FlyBaseID:FBgn0020655 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_014195.1 Gene:SPS18 / 855517 SGDID:S000005148 Length:300 Species:Saccharomyces cerevisiae


Alignment Length:259 Identity:61/259 - (23%)
Similarity:107/259 - (41%) Gaps:69/259 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RRVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVRSVTMDKWKDIE 71
            |:.|...|....|:.||||.:.|||:||.::||:||:.|:...|.:|.::..|:|:|||.:::.:
Yeast    13 RKRLLRAKKAAGNNNCFECKSVNPQFVSCSFGIFICVNCANLLRGMGTNIFCVKSITMDNFEEKD 77

  Fly    72 LEKMKAGGNRNAREFLEDQEDWNERAPITQRYNSKAAALYRDKIATLAQGKSWDLKEAQGRVGSN 136
            :.:::..||.....||..........|:.::|::..|..|:.::|                    
Yeast    78 VRRVEKSGNNRFGSFLSKNGILQNGIPLREKYDNLFAKSYKRRLA-------------------- 122

  Fly   137 NSFSSGGSSNSSYQSRPSATGYGGNGGYQNGGGAEPGGYQQY---QTQEFKDQKEEFFSRRQVEN 198
            |...|...:.:.|.            |:.|        :|||   .|.:.:|:     :.|::.|
Yeast   123 NEVRSNDINRNMYL------------GFNN--------FQQYTNGATSQIRDR-----TLREISN 162

  Fly   199 ASRPENLPPSQGGKYAGFGFTREPPPKT------QSQELFDSTLSTLASGWSLFSTNASKLAST 256
                 |...|:|.::.       .|.|.      |..|.|.:.||   |..:|...|.:...||
Yeast   163 -----NSNASEGAEFV-------LPEKVLGSDNFQDCERFPACLS---SERNLDENNVTSATST 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP1NP_524040.2 ArfGap 7..114 CDD:279720 33/106 (31%)
SPS18NP_014195.1 COG5347 6..300 CDD:227651 61/259 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1735
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003790
OrthoInspector 1 1.000 - - otm46882
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR46395
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.