DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP1 and AGE2

DIOPT Version :9

Sequence 1:NP_524040.2 Gene:ArfGAP1 / 39417 FlyBaseID:FBgn0020655 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_012220.3 Gene:AGE2 / 854767 SGDID:S000001306 Length:298 Species:Saccharomyces cerevisiae


Alignment Length:333 Identity:81/333 - (24%)
Similarity:127/333 - (38%) Gaps:100/333 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RRVLQELKPQDENSKCFECGTH-NPQWVSVTYGIWICLECSGKHRSLGVHLSFVRSVTMDKWKDI 70
            ::.|..|.....||.|.:|... :|:|.|.:.|::||::|:|.|||||.|:|.|:||.:|.||:.
Yeast     8 KKALSALLRDPGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISKVKSVDLDTWKEE 72

  Fly    71 ELEKM-KAGGNRNAREFLE----DQEDWNERAPITQRYNSKAAALYRDKIATLAQGKSW--DLKE 128
            .|.|: :...|..|..:.|    |:        :.||..:..::| ::.|....:.|.|  ||..
Yeast    73 HLVKLIQFKNNLRANSYYEATLADE--------LKQRKITDTSSL-QNFIKNKYEYKKWIGDLSS 128

  Fly   129 AQGRVGSNNSFSSGGSSNSSYQSRPSATGYGGNGGYQNGGGAEPGGYQQYQTQEFKDQKEEFFSR 193
            .:|...|........|:|.|..:..:......|            ..|:.|||            
Yeast   129 IEGLNDSTEPVLHKPSANHSLPASNARLDQSSN------------SLQKTQTQ------------ 169

  Fly   194 RQVENASRPENLPPSQGGKYAGFGFTREPPPKTQSQELFDSTLSTLASGWSLFSTNASKLASTAK 258
                        |||.                         .|||..|..||.:...|.|:.|..
Yeast   170 ------------PPSH-------------------------LLSTSRSNTSLLNLQVSSLSKTTS 197

  Fly   259 EKAVTTVNLASTKIKEGTLLDSVQCGVTDVASKVTDMGKRGWNNLAGSNISSPQGGYNDPNFEDS 323
            ..:||:   ::|         |:....|...::|.:.|:|  |:|..|.:|.    |:.|    |
Yeast   198 NTSVTS---SAT---------SIGAANTKTGNRVGEFGQR--NDLKKSILSL----YSKP----S 240

  Fly   324 SAYQRSNS 331
            :..|..||
Yeast   241 AQTQSQNS 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP1NP_524040.2 ArfGap 7..114 CDD:279720 36/112 (32%)
AGE2NP_012220.3 COG5347 1..298 CDD:227651 81/333 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.