DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP1 and smap1

DIOPT Version :9

Sequence 1:NP_524040.2 Gene:ArfGAP1 / 39417 FlyBaseID:FBgn0020655 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_021336343.1 Gene:smap1 / 777731 ZFINID:ZDB-GENE-060920-2 Length:483 Species:Danio rerio


Alignment Length:377 Identity:88/377 - (23%)
Similarity:146/377 - (38%) Gaps:86/377 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVRSVTMDKWKDIELE 73
            :|.::..:|:|..|.:|....|:|.|...|::||:.|:|.||:||||:|.|:||.:|:|...:::
Zfish    20 ILSKMLREDDNKYCADCEAKGPRWASWNLGVFICIRCAGIHRNLGVHISRVKSVNLDQWTPEQIQ 84

  Fly    74 KMKAGGNRNAREFLEDQEDWNERAPITQRYNSKAAALY-RDKIATLAQGKSWDLKEAQGRVGSNN 137
            .:::.||..||:..|.....|.|.|.|    .:|...: |||   ..:.|.:|.....|.:.|::
Zfish    85 SVQSMGNTKARQLYEAHLPENFRRPQT----DQAVEFFIRDK---YERKKYYDKNSVNGAIKSSD 142

  Fly   138 SFSSGGSSNSSYQSRPSATGYGGNGGYQNGGGAEPGGYQQYQTQEFKDQKEEFFSRRQVENASRP 202
            :.....||.||..:..|..                       .:|.:.:|||....:..:..::|
Zfish   143 AALPSVSSPSSQAAEKSKL-----------------------EKEREKKKEEKKREKDTDKENKP 184

  Fly   203 ENLPPSQGGKYAGFGFTREPPPKTQSQELFDSTLSTLASGWSLFSTNASKLASTAKEKAVTTVNL 267
            ..|                  .|.:.....||.:|...|.                |.|:..:.|
Zfish   185 AVL------------------EKKREDNQIDSRISPKKSA----------------EPAIDLLGL 215

  Fly   268 ASTKIKEGTLLDSVQCGVTDVASKVTDMGKRGWNNLAGSNISSP-QGGYNDPNFEDSSA--YQRS 329
            .:..:...    |...|.:..|....|:      ::.|..:|:| ....|......|.|  ..::
Zfish   216 DAPTVGSA----SSGAGTSSAAPISDDL------DIFGPMVSNPLPSNSNSSQVSSSKAAGSAQA 270

  Fly   330 NSVGGNLAGGLGQQSGV---SDSDWGGWQDNGNSKSHMTSSSSYHNQLSSSS 378
            :|.||.:||..|..|..   .|.|... :.:||||    :..|....||..|
Zfish   271 SSAGGAVAGATGTGSAAPAQGDLDLFS-ETSGNSK----AEDSAKKPLSKDS 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP1NP_524040.2 ArfGap 7..114 CDD:279720 36/105 (34%)
smap1XP_021336343.1 ArfGap 18..132 CDD:307528 40/118 (34%)
Med15 <329..>466 CDD:312941
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.