DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP1 and AGAP5

DIOPT Version :9

Sequence 1:NP_524040.2 Gene:ArfGAP1 / 39417 FlyBaseID:FBgn0020655 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001137472.1 Gene:AGAP5 / 729092 HGNCID:23467 Length:686 Species:Homo sapiens


Alignment Length:123 Identity:40/123 - (32%)
Similarity:59/123 - (47%) Gaps:23/123 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASPRTRRVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVRSVTMD 65
            :.|......||.::....|:.|.:..|.||:|.|:..|:.:|:||||.|||||..||.|||:.:|
Human   458 LTSQSEAMALQSIQNMRGNAHCVDYETQNPKWASLNLGVLMCIECSGIHRSLGTRLSRVRSLELD 522

  Fly    66 KWKDIELEK-MKAGGN----------------RNAREFLEDQEDWNERAPITQRYNSK 106
            .| .:||.| |.:.||                .:.:...|::|.|     |..:|..|
Human   523 DW-PVELRKVMSSIGNDLANSIWEGSSQGQTKPSVKSTREEKERW-----IRSKYEEK 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP1NP_524040.2 ArfGap 7..114 CDD:279720 39/117 (33%)
AGAP5NP_001137472.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 205..242
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 256..278
PH_AGAP 280..447 CDD:241281
PH 283..442 CDD:278594
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 382..404
ArfGap 466..580 CDD:279720 39/115 (34%)
ANK <590..677 CDD:238125
Ank_2 591..681 CDD:289560
ANK repeat 591..621 CDD:293786
ANK repeat 623..654 CDD:293786
ANK 1 623..652
ANK 2 656..685
ANK repeat 656..681 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.