DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP1 and Asap3

DIOPT Version :9

Sequence 1:NP_524040.2 Gene:ArfGAP1 / 39417 FlyBaseID:FBgn0020655 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_038967221.1 Gene:Asap3 / 684122 RGDID:1593929 Length:903 Species:Rattus norvegicus


Alignment Length:83 Identity:30/83 - (36%)
Similarity:46/83 - (55%) Gaps:0/83 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TRRVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVRSVTMDKWKDI 70
            |..::.|:|.:..|..|.:||..:|.|:|...|:..|::|||.||.|||..|.::|:|:|.....
  Rat   424 TNMLVAEVKSRPGNDHCCDCGAADPTWLSTNLGVLTCIQCSGVHRELGVRYSRIQSLTLDLLGPS 488

  Fly    71 ELEKMKAGGNRNAREFLE 88
            ||......||.:..|.:|
  Rat   489 ELLLALNIGNSHFNEVME 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP1NP_524040.2 ArfGap 7..114 CDD:279720 29/82 (35%)
Asap3XP_038967221.1 BAR_ASAP3 35..243 CDD:153324
PH_ASAP 294..400 CDD:270071
ArfGap_ASAP3 423..543 CDD:350087 30/83 (36%)
ANK repeat 550..583 CDD:293786
ANK repeat 585..618 CDD:293786
Ank_2 589..674 CDD:403870
ANK repeat 620..651 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.