DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ArfGAP1 and 9030624G23Rik

DIOPT Version :9

Sequence 1:	NP_524040.2	Gene:	ArfGAP1 / 39417	FlyBaseID:	FBgn0020655	Length:	468	Species:	Drosophila melanogaster
Sequence 2:	NP_001369748.1	Gene:	9030624G23Rik / 66808	MGIID:	1914058	Length:	591	Species:	Mus musculus

Alignment Length:	68	Identity:	20/68 - (29%)
Similarity:	31/68 - (45%)	Gaps:	10/68 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly   222 PPPKTQSQELFDSTLSTLASGWSLFSTNASKLASTA---KEKAVT----TVNLASTKIKEGTLLD 279
            |.|.:.|:.:.::....:|...|.|:|..::...||   :|.|||    .||...   :|..|||
Mouse     2 PDPISVSEFVAETLEDYMAPTASSFTTRTAQCRDTAAAIEEDAVTYDDVHVNFTG---EEWKLLD 63

  Fly   280 SVQ 282
            ..|
Mouse    64 PSQ 66

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ArfGAP1	NP_524040.2	ArfGap	7..114	CDD:279720
9030624G23Rik	NP_001369748.1	KRAB	45..85	CDD:396083	9/25 (36%)
		C2H2 Zn finger	118..138	CDD:275368
		C2H2 Zn finger	147..166	CDD:275368
		zf-H2C2_2	158..182	CDD:404364
		C2H2 Zn finger	174..194	CDD:275368
		COG5048	198..571	CDD:227381
		C2H2 Zn finger	202..222	CDD:275368
		C2H2 Zn finger	230..250	CDD:275368
		C2H2 Zn finger	258..278	CDD:275368
		C2H2 Zn finger	286..306	CDD:275368
		C2H2 Zn finger	314..334	CDD:275368
		C2H2 Zn finger	342..362	CDD:275368
		C2H2 Zn finger	370..390	CDD:275368
		C2H2 Zn finger	398..418	CDD:275368
		C2H2 Zn finger	426..446	CDD:275368
		C2H2 Zn finger	454..474	CDD:275368
		C2H2 Zn finger	482..502	CDD:275368
		C2H2 Zn finger	510..529	CDD:275368
		C2H2 Zn finger	538..558	CDD:275368
		C2H2 Zn finger	566..586	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5347
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900