DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP1 and Agap2

DIOPT Version :9

Sequence 1:NP_524040.2 Gene:ArfGAP1 / 39417 FlyBaseID:FBgn0020655 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_038935796.1 Gene:Agap2 / 65218 RGDID:628844 Length:1304 Species:Rattus norvegicus


Alignment Length:141 Identity:46/141 - (32%)
Similarity:66/141 - (46%) Gaps:29/141 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVRSVTMDKW-KDIELE 73
            :|.::....||.|.:||..||.|.|:..|..||:||||.||:||.|||.|||:.:|.| :::.| 
  Rat   928 IQAIRNAKGNSTCVDCGAPNPTWASLNLGALICIECSGIHRNLGTHLSRVRSLDLDDWPRELTL- 991

  Fly    74 KMKAGGNRNAREF----------------LEDQEDWNERAPITQRYNSKAAALYRDKIATLAQ-- 120
            .:.|.||..|...                .|::|.|     |..:|..   .|:...:.|..:  
  Rat   992 VLTAIGNDTANRVWESDTRGRAKPTRDSSREERESW-----IRAKYEQ---LLFLAPLGTTEEPL 1048

  Fly   121 GKS-WDLKEAQ 130
            |:. |...|||
  Rat  1049 GRQLWAAVEAQ 1059

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP1NP_524040.2 ArfGap 7..114 CDD:279720 40/120 (33%)
Agap2XP_038935796.1 PRK07764 <37..174 CDD:236090
Centaurin_gamma 401..560 CDD:133303
PH_AGAP 668..908 CDD:241281
ArfGap_AGAP 926..1033 CDD:350065 38/110 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.