DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP1 and arap1a

DIOPT Version :9

Sequence 1:NP_524040.2 Gene:ArfGAP1 / 39417 FlyBaseID:FBgn0020655 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_700481.5 Gene:arap1a / 571767 ZFINID:ZDB-GENE-030131-6226 Length:1092 Species:Danio rerio


Alignment Length:101 Identity:32/101 - (31%)
Similarity:52/101 - (51%) Gaps:8/101 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVRSVTMDK--WKDIELEKMKAGGNR 81
            |..|.:|.:..|:|.||...:.:|.:|:|.||:||.::|.|||:.:|:  |.|..:......||.
Zfish   274 NRICADCSSSMPEWASVNLCVLLCEKCAGAHRNLGQNISKVRSLKLDERVWTDDLIRVFLMLGNG 338

  Fly    82 NAREFLEDQEDWNERAPITQRYNSKAAALYRDKIAT 117
            .|.:|      |....|.::|.::.|.:..|.|..|
Zfish   339 KANKF------WGANIPPSERLSASANSEQRLKHIT 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP1NP_524040.2 ArfGap 7..114 CDD:279720 30/96 (31%)
arap1aXP_700481.5 PH 56..147 CDD:278594
PH-like 57..149 CDD:302622
PH-like 171..251 CDD:302622
ArfGap 266..378 CDD:279720 32/101 (32%)
PH-like 463..566 CDD:302622
PH 465..567 CDD:278594
PH-like 580..660 CDD:302622
RhoGAP_ARAP 665..845 CDD:239850
UBQ 887..968 CDD:294102
PH-like 973..1090 CDD:302622
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.