DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP1 and asap2a

DIOPT Version :9

Sequence 1:NP_524040.2 Gene:ArfGAP1 / 39417 FlyBaseID:FBgn0020655 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_021322892.1 Gene:asap2a / 570669 ZFINID:ZDB-GENE-041210-256 Length:1003 Species:Danio rerio


Alignment Length:83 Identity:35/83 - (42%)
Similarity:46/83 - (55%) Gaps:0/83 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TRRVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVRSVTMDKWKDI 70
            |:.:|.|:|....|..|.:||...|.|:|...||..|:||||.||.||||.|.::|:|:|.....
Zfish   432 TKAILGEVKRMAGNDVCCDCGAPGPTWLSTNLGILTCIECSGIHRELGVHYSRIQSLTLDVLSTS 496

  Fly    71 ELEKMKAGGNRNAREFLE 88
            ||...|..||....|.:|
Zfish   497 ELLLAKNVGNAGFNEIME 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP1NP_524040.2 ArfGap 7..114 CDD:279720 34/82 (41%)
asap2aXP_021322892.1 BAR_ASAP2 34..257 CDD:153326
PH_ASAP 309..415 CDD:270071
ArfGap 433..550 CDD:307528 34/82 (41%)
ANK repeat 562..594 CDD:293786
ANK <597..685 CDD:238125
ANK repeat 597..630 CDD:293786
ANK repeat 632..663 CDD:293786
SH3 945..1000 CDD:327375
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.