DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP1 and asap2b

DIOPT Version :9

Sequence 1:NP_524040.2 Gene:ArfGAP1 / 39417 FlyBaseID:FBgn0020655 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001038398.2 Gene:asap2b / 560581 ZFINID:ZDB-GENE-030131-5060 Length:1024 Species:Danio rerio


Alignment Length:127 Identity:44/127 - (34%)
Similarity:60/127 - (47%) Gaps:14/127 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TRRVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVRSVTMDKWKDI 70
            |:.::.|:|....|..|.:||..||.|:|...|:.||:||||.||.:|||.|.::|:|:|.....
Zfish   420 TKAIVGEVKKMSGNDVCCDCGASNPTWLSTNLGVLICIECSGIHREMGVHYSRIQSLTLDLLGTS 484

  Fly    71 ELEKMKAGGNRNAREFLE-----------DQEDWNERAP-ITQRYNSK--AAALYRDKIATL 118
            ||....:.||....|.:|           ...|...|.. ||.:|..|  |...|.|..|.|
Zfish   485 ELLLANSVGNAAFNEIMEAKLSSEIPKPNPSSDMQVRKDFITAKYTEKRFAQKKYADNAARL 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP1NP_524040.2 ArfGap 7..114 CDD:279720 40/120 (33%)
asap2bNP_001038398.2 BAR 34..248 CDD:299863
PH_ASAP 297..403 CDD:270071
PH 306..393 CDD:278594
ArfGap 421..537 CDD:279720 39/115 (34%)
ANK repeat 548..579 CDD:293786
ANK <575..672 CDD:238125
Ank_5 <584..626 CDD:290568
ANK repeat 584..617 CDD:293786
Ank_5 606..660 CDD:290568
ANK repeat 619..650 CDD:293786
SH3_ASAP2 966..1021 CDD:212899
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.