DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP1 and arap3

DIOPT Version :9

Sequence 1:NP_524040.2 Gene:ArfGAP1 / 39417 FlyBaseID:FBgn0020655 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_687312.3 Gene:arap3 / 558931 ZFINID:ZDB-GENE-091019-1 Length:1664 Species:Danio rerio


Alignment Length:284 Identity:54/284 - (19%)
Similarity:90/284 - (31%) Gaps:112/284 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVRSVTMDK--WKDIE 71
            |.:::.....|..|.:|...||.|.|:...:.||..|:|:||.||..:|.|:|:.:|.  |.:..
Zfish   639 VAEKIWSNRSNKICADCKAINPDWASINLCVVICKNCAGQHRGLGTMVSKVQSLKLDTSVWSNEI 703

  Fly    72 LEKMKAGGNRNAREFLEDQEDWNERAPITQRYNSKAAALYRDKIATLAQGKSWDLKEAQGRVGSN 136
            ::.....||..|.||      |..|.|:::..:..|.                            
Zfish   704 VQLFIMLGNDRANEF------WAARLPVSEELDCDAT---------------------------- 734

  Fly   137 NSFSSGGSSNSSYQSRPSATGYGGNGGYQNGGGAEPGGYQQYQTQEFKDQKEEFFSRRQVENASR 201
                                                           .:|:.||.|.:..|    
Zfish   735 -----------------------------------------------PEQRREFISHKYKE---- 748

  Fly   202 PENLPPSQGGKYAGFGFTREPPPKTQSQELFDSTLSTLASGWSLFST--------NASKLA-STA 257
                     |:|      |.|.|...|||.....|.|..:..:|..|        .|::|| :..
Zfish   749 ---------GRY------RHPHPSFSSQEELLKALCTAVTEQNLLKTVTQIFAEAEAARLADANG 798

  Fly   258 KEKAVTTVNLASTKIKEGTLLDSV 281
            .:|.|:. :.:.|:..:..:.|.:
Zfish   799 NDKRVSP-HYSYTQSADSCVYDEI 821

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP1NP_524040.2 ArfGap 7..114 CDD:279720 30/106 (28%)
arap3XP_687312.3 SAM_Arap1,2,3 8..70 CDD:188889
SAM 9..70 CDD:197735
PH 436..527 CDD:278594
PH1_ARAP 437..529 CDD:270073
PH2_ARAP 538..627 CDD:270074
PH 545..631 CDD:278594
ArfGap 638..754 CDD:279720 38/214 (18%)
PH3_ARAP 824..937 CDD:270076
PH 825..936 CDD:278594
PH-like 950..1045 CDD:302622
PH 954..1045 CDD:278594
RhoGAP_ARAP 1050..1228 CDD:239850
RA 1261..1355 CDD:279168
PH5_ARAP 1357..1477 CDD:270079
PH 1369..1469 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.