DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP1 and CenB1A

DIOPT Version :9

Sequence 1:NP_524040.2 Gene:ArfGAP1 / 39417 FlyBaseID:FBgn0020655 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_524458.1 Gene:CenB1A / 42735 FlyBaseID:FBgn0039056 Length:828 Species:Drosophila melanogaster


Alignment Length:458 Identity:105/458 - (22%)
Similarity:162/458 - (35%) Gaps:125/458 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PRTRRV-LQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVRSVTMDKW 67
            |..||: .:|......|:.|.:|.:..|:|.|:..||.:|:||||.|||||||.|.|||:|:|.|
  Fly   377 PAKRRIHWEEFLKIPGNAYCCDCRSPEPRWASINLGITLCIECSGVHRSLGVHYSKVRSLTLDAW 441

  Fly    68 KDIELEKMKAGGNRNAREFLEDQ--EDWNERAPITQ-RYNSKAA---ALYRDKIATLAQGKSWDL 126
            :...::.|...||.......|.:  :|...:.|..| ....:.|   |.|.::.......|..:|
  Fly   442 ESENVKVMMELGNEVVNRIYEARIGDDCGLKKPTEQCEIGVREAWIKAKYVERRFVCGMPKPQEL 506

  Fly   127 KEAQGRVGSNNSFSSGGSSNSSYQSRPSATGYGGNGGYQNGGGAEPGGYQQYQTQEFKDQKEEFF 191
            ..::  .....|..|||....         |..|..|.........||.:::..::.:       
  Fly   507 LASE--TAEVLSIDSGGVVED---------GESGGSGIAKRATLSLGGTRKWAVKKLR------- 553

  Fly   192 SRRQVENASRPENLPPSQGGKYAGFGFTREPPPKTQSQELFDSTLSTLASGWSL--------FST 248
             |||.:.:.                       |||.|.:  .|..:|..:|..|        .:.
  Fly   554 -RRQKQRSI-----------------------PKTLSDD--PSIYNTAKTGDELEDDDDDESINI 592

  Fly   249 NASKLASTAKEKAVTTVNLASTKIKEGTLLDSVQCGVTDVASKVTDMGKRGWNNLAGSNISSPQG 313
            .:..|:.:..:..|...:||..:::...:|.|.|        :.||         ..|:..||: 
  Fly   593 PSMSLSISRDDLLVIGDDLALDRLETPGILGSDQ--------ESTD---------GESDAESPE- 639

  Fly   314 GYNDPNFEDSSAYQ--RSNSVGGNL-----AGGLGQQSGVSDSDWGGWQDNGNSKSHMTSSSSYH 371
               :..|....|.|  ...||..||     |..||     :|..|...||...|..|....|   
  Fly   640 ---ELPFSQLDANQLLYMASVVHNLPVMCMAFALG-----ADKMWKNPQDRQRSFLHQAVIS--- 693

  Fly   372 NQLSSSSGGGTASA-------GLTRDA-DWSGFEATNYQSS-------------ETSYQNASSGG 415
                     |:..|       |...|| |..|:.|.:..::             :.:|..:||.|
  Fly   694 ---------GSVMACEFLLLNGAAIDAVDEMGYSALHISTAKGHIAQVYLLLKHKAAYDLSSSDG 749

  Fly   416 STA 418
            ..|
  Fly   750 KKA 752

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP1NP_524040.2 ArfGap 7..114 CDD:279720 40/113 (35%)
CenB1ANP_524458.1 BAR_ACAPs 18..217 CDD:153287
PH 259..352 CDD:278594
PH_ACAP 260..355 CDD:270070
ArfGap 384..497 CDD:279720 38/112 (34%)
ANK 652..768 CDD:238125 27/118 (23%)
Ank_4 683..736 CDD:290365 11/64 (17%)
ANK repeat 687..713 CDD:293786 7/37 (19%)
ANK repeat 715..746 CDD:293786 3/30 (10%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464113
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.