DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ArfGAP1 and AGAP6

DIOPT Version :9

Sequence 1:	NP_524040.2	Gene:	ArfGAP1 / 39417	FlyBaseID:	FBgn0020655	Length:	468	Species:	Drosophila melanogaster
Sequence 2:	NP_001071133.2	Gene:	AGAP6 / 414189	HGNCID:	23466	Length:	686	Species:	Homo sapiens

Alignment Length:	123	Identity:	40/123 - (32%)
Similarity:	62/123 - (50%)	Gaps:	23/123 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly     1 MASPRTRRVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVRSVTMD 65
            :.|......||.::....|:.|.:|.|.||:|.|:..|:.:|:||||.|||||.|||.|||:.:|
Human   458 LTSQSEAMALQSIQNMRGNAHCVDCETQNPKWASLNLGVLMCIECSGIHRSLGPHLSRVRSLELD 522

  Fly    66 KWKDIELEKMKA------------GGNR-----NAREFLEDQEDWNERAPITQRYNSK 106
            .| .:||.|:.:            |.::     :.:...|::|.|     |..:|..|
Human   523 DW-PVELRKVMSSIVNDLANSIWEGSSQGQTKPSEKSTREEKERW-----IRSKYEEK 574

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ArfGAP1	NP_524040.2	ArfGap	7..114	CDD:279720	39/117 (33%)
AGAP6	NP_001071133.2	PH_AGAP	280..447	CDD:241281
		PH	283..442	CDD:278594
		ArfGap	466..580	CDD:279720	39/115 (34%)
		Ank_2	591..681	CDD:289560
		ANK repeat	591..621	CDD:293786
		ANK	<594..677	CDD:238125
		ANK repeat	623..654	CDD:293786
		ANK repeat	656..681	CDD:293786
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910