DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP1 and Appl2

DIOPT Version :9

Sequence 1:NP_524040.2 Gene:ArfGAP1 / 39417 FlyBaseID:FBgn0020655 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001102211.1 Gene:Appl2 / 362860 RGDID:1563028 Length:662 Species:Rattus norvegicus


Alignment Length:231 Identity:46/231 - (19%)
Similarity:80/231 - (34%) Gaps:55/231 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 ELFDSTL-STLASGWSLFSTNASKLASTAKEKAVTTVNLASTKIKEGTLLDSVQCGVTDVASKVT 293
            |:|..:: ..|:|...:..:...:|.:.|.:..|:...|.|..       :||.....|||:...
  Rat   216 EMFSKSMDGFLSSVTDMVQSIQVELEAEADKMRVSQQELLSVS-------ESVYTPDIDVATPQI 273

  Fly   294 D---MGKRGWNNLAGSNISSPQGGYNDPNFEDSSAYQRSNSVGGNL--------AGGLGQQSGVS 347
            :   :.|.|:.||....      |.....:|....:.:    ||||        ||||.|.    
  Rat   274 NRNLIQKTGYLNLRNKT------GLVTTTWERLYFFTQ----GGNLMCQPRGAVAGGLIQD---- 324

  Fly   348 DSDWGGWQDNGNSKSHMTSSSSYHNQLSSSSGGGTASAGLTRDADWSGFEATNYQSSETSYQNAS 412
                   .||.:..:.......|..|:|:.||    ..|:...|:           |...|:...
  Rat   325 -------LDNCSVMAVDCEDRRYCFQISTPSG----KPGIILQAE-----------SRKEYEEWI 367

  Fly   413 SGGSTARRNMKLQDTSQKLSEGFESLDVKSVKPKTA 448
            ...:...|.:.|.|..:.::.......:::|.|.|:
  Rat   368 CAINNISRQIYLTDNPEAVAIKLNQTALQAVTPITS 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP1NP_524040.2 ArfGap 7..114 CDD:279720
Appl2NP_001102211.1 BAR_APPL2 20..234 CDD:153316 4/17 (24%)
BAR-PH_APPL 252..376 CDD:270067 33/166 (20%)
PTB_APPL 480..613 CDD:269980
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 643..662
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.