DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP1 and Git

DIOPT Version :9

Sequence 1:NP_524040.2 Gene:ArfGAP1 / 39417 FlyBaseID:FBgn0020655 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_610599.3 Gene:Git / 36122 FlyBaseID:FBgn0033539 Length:731 Species:Drosophila melanogaster


Alignment Length:69 Identity:25/69 - (36%)
Similarity:38/69 - (55%) Gaps:2/69 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASP--RTRRVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVRSVTM 64
            |:|  .||..:...|.:.:...|.:||..:|.|.|:..||.:|.:|...|||||.|:|.|:|:..
  Fly    27 ATPTISTRSKMPRGKSRLQTEVCGDCGAGDPSWASINRGILLCADCCSVHRSLGRHISIVKSLRQ 91

  Fly    65 DKWK 68
            ..|:
  Fly    92 GNWE 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP1NP_524040.2 ArfGap 7..114 CDD:279720 22/62 (35%)
GitNP_610599.3 ArfGap 48..164 CDD:279720 20/48 (42%)
Ank_2 187..279 CDD:289560
ANK <187..270 CDD:238125
ANK repeat 187..213 CDD:293786
ANK repeat 215..247 CDD:293786
ANK repeat 249..279 CDD:293786
GIT_SHD 314..342 CDD:285690
GIT 374..404 CDD:128828
GIT1_C 609..727 CDD:289013
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464119
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.