DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP1 and CenG1A

DIOPT Version :9

Sequence 1:NP_524040.2 Gene:ArfGAP1 / 39417 FlyBaseID:FBgn0020655 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_723849.1 Gene:CenG1A / 34803 FlyBaseID:FBgn0028509 Length:995 Species:Drosophila melanogaster


Alignment Length:360 Identity:85/360 - (23%)
Similarity:121/360 - (33%) Gaps:147/360 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVRSVTMDKWKDIELEKMKAGGNRNA 83
            |..|.:||..||:|.|:..|:.:|:||||.||:||.|:|.|||:.:|.|....|..|.|.||..|
  Fly   714 NGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGLDDWPSPHLSVMLAIGNSLA 778

  Fly    84 REFLEDQEDWNERAPITQRYNSKAAALYRDKIATLAQGKSWDLKEAQGRVGSNNSFSSGGSSNSS 148
            ....|.    |.|    ||....:.|...||       :.|                    ..|.
  Fly   779 NSVWES----NTR----QRVKPTSQASREDK-------ERW--------------------VRSK 808

  Fly   149 YQSRPSATGYGGNGGYQNGGGAEPGGYQQYQTQEFKDQKEEFFSRRQVENASRPENLPPSQGGKY 213
            |:::...|..|      ||..|.|.                                 ||.|   
  Fly   809 YEAKEFLTPLG------NGSSAHPS---------------------------------PSPG--- 831

  Fly   214 AGFGFTREPPPKTQSQELFDSTLSTLASGWSLFSTNASKLASTAKEKAVTTVNLASTKIKEGTLL 278
                           |:|.::.:.      :...:..|.||:...|  ||..|:::..::...||
  Fly   832 ---------------QQLIEAVIR------ADIKSIVSILANCPSE--VTNANVSARDVRTPLLL 873

  Fly   279 DSVQCGVTDVA-----------SKVTD-MGK------RGWNNL-------------AGSNISSP- 311
               .|.:.::|           .|.|| .|:      |...:|             ||:.|.:| 
  Fly   874 ---ACAIGNLAIAQLLIWNGANIKHTDHEGRTCLAYARAAQSLATAKSIKAAAAAQAGTTIPAPA 935

  Fly   312 ---QGGYNDP--NFEDSSAYQRSNSVGGNLAGGLG 341
               .||...|  |.||::|..       .|..|||
  Fly   936 PPTNGGIPAPQYNVEDTTALV-------ELLEGLG 963

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP1NP_524040.2 ArfGap 7..114 CDD:279720 37/94 (39%)
CenG1ANP_723849.1 SelP_N <5..41 CDD:282453
Centaurin_gamma 143..300 CDD:133303
RAS 144..295 CDD:214541
PH_AGAP 451..686 CDD:241281
PH 454..>521 CDD:278594
ArfGap 702..818 CDD:279720 43/138 (31%)
ANK <834..907 CDD:238125 16/83 (19%)
ANK repeat 834..866 CDD:293786 8/39 (21%)
Ank_5 859..907 CDD:290568 9/50 (18%)
ANK repeat 868..897 CDD:293786 5/31 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464129
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.