DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP1 and Agap1

DIOPT Version :9

Sequence 1:NP_524040.2 Gene:ArfGAP1 / 39417 FlyBaseID:FBgn0020655 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_835220.1 Gene:Agap1 / 347722 MGIID:2653690 Length:857 Species:Mus musculus


Alignment Length:168 Identity:48/168 - (28%)
Similarity:66/168 - (39%) Gaps:42/168 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASPRTRRVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVRSVTMD 65
            :.|......||.::....||.|.:|.|.||.|.|:..|..:|:||||.||:||.|||.|||:.:|
Mouse   603 LTSQSEAMALQSIRNMRGNSHCVDCDTQNPNWASLNLGALMCIECSGIHRNLGTHLSRVRSLDLD 667

  Fly    66 KWKDIELEKMKAGGNRNAREF----------------LEDQEDWNERAPITQRYNSK-------- 106
            .|....::.|.:.||..|...                .|::|.|     |..:|..|        
Mouse   668 DWPMELIKVMSSIGNELANSVWEEGSQGRTKPSLDSTREEKERW-----IRAKYEQKLFLAPLPC 727

  Fly   107 -------------AAALYRDKIATLAQGKSWDLKEAQG 131
                         |....|..|..||.|...::.|..|
Mouse   728 TEFSLGQQLLRATAEEDLRTVILLLAHGSRDEVNETCG 765

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP1NP_524040.2 ArfGap 7..114 CDD:279720 41/143 (29%)
Agap1NP_835220.1 Small GTPase-like 66..276
Centaurin_gamma 72..229 CDD:133303
RAS 73..235 CDD:214541
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 267..342
PH_AGAP 344..592 CDD:241281
PH 347..>411 CDD:278594
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 407..431
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 497..547
ArfGap 611..725 CDD:279720 39/118 (33%)
Ank_2 736..826 CDD:289560 8/30 (27%)
ANK 736..>825 CDD:238125 8/30 (27%)
ANK repeat 768..799 CDD:293786
ANK 1 768..797
ANK 2 801..830
ANK repeat 801..826 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.